Property Summary

NCBI Gene PubMed Count 55
PubMed Score 0.00
PubTator Score 10.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession P01854
Symbols IgE

Gene

PDB

1F6A   1FP5   1G84   1IGE   1O0V   2WQR   2Y7Q   3H9Y   3H9Z   3HA0   4EZM   4GKO   4GRG   4GT7   4J4P   4KI1   5ANM   5HYS  

Gene RIF (45)

PMID Text
27084682 Asthmatic subjects with high total serum IgE show increased macrophage expression of TLR4 in induced sputum.
26250770 Sputum HMGB1 levels were higher in children with asthma than in healthy controls, and were positively related to total IgE levels.
25966159 IgE levels in the third trimester of pregnancy and cord blood are strongly related to birth outcomes of fetal growth restriction
25765733 One third of 116 symptomatic bakers showed sIgE to lupine. At least some of these sensitizations were based on crossreactivity between lupine and wheat flour.
25765158 The majority of symptomatic peanut-allergic Austrian patients are sensitized to Ara h 2 and Ara h 6 producing elevated leveles of IgE.
25658351 The results explain how initial membrane interactions of clustered IgE-Fcepsilon RI complexes lead to downstream cellular responses.
25514176 IgE mediated type 1 hypersensitivity can cause increase in capillary permeability and weakened the charge barrier; hence, it could be considered as one of the causes of proteinuria in Henoch-Schonlein purpura.
24736882 Allergen-specific IgE levels are related to increased HLA-G in patients with allergic rhinitis and asthma.
24598915 Crystal structure of the CD23-Fc3-4 complex with different molecular-packing constraints.
24477463 Currently, neither dose reductions nor treatment withdrawal can be recommended in patients with severe allergic asthma and long term treatment with omalizumab. [review]
More...

AA Sequence

ASTQSPSVFPLTRCCKNIPSNATSVTLGCLATGYFPEPVMVTWDTGSLNGTTMTLPATTLTLSGHYATIS      1 - 70
LLTVSGAWAKQMFTCRVAHTPSSTDWVDNKTFSVCSRDFTPPTVKILQSSCDGGGHFPPTIQLLCLVSGY     71 - 140
TPGTINITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCA    141 - 210
DSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTV    211 - 280
TSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNF    281 - 350
MPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQR    351 - 420
AVSVNPGK                                                                  421 - 428
//

Text Mined References (56)

PMID Year Title
27084682 2016 Expression of toll-like receptors 2 and 4 in subjects with asthma by total serum IgE level.
26250770 2015 Sputum high mobility group box-1 in asthmatic children: a noninvasive sensitive biomarker reflecting disease status.
25966159 2015 Serum immunoglobulin E level and its impact on the pregnancy outcome associated with fetal growth restriction: a prospective cohort study.
25765733 2015 IgE sensitization to lupine in bakers - cross-reactivity or co-sensitization to wheat flour?
25765158 2015 Component-resolved IgE profiles in Austrian patients with a convincing history of peanut allergy.
25658351 2015 Nanodomains in early and later phases of Fc?RI signalling.
25514176 2014 Relationship between immune parameters and organ involvement in children with Henoch-Schonlein purpura.
24736882 2014 Serum-soluble HLA-G is associated with specific IgE in patients with allergic rhinitis and asthma.
24598915 2014 A range of C?3-C?4 interdomain angles in IgE Fc accommodate binding to its receptor CD23.
24477463 2014 [Disease modification and duration of omalizumab treatment in patients with severe allergic asthma].
More...