Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

PDB (87)

AA Sequence

EDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALN      1 - 70
DSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSVSYQQ     71 - 140
GVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDF                                     141 - 177
//

Text Mined References (13)

PMID Year Title