Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Synonym

Accession P01848
Symbols TRA
IMD7
TCRA
TRCA

Gene

PDB

2AK4   2NX5   3KXF   4P4K   5BS0   2PO6   3SDX   4WW2   4WWK   5EU6   1YMM   1ZGL   5HYJ   1AO7   1BD2   1OGA   1QRN   1QSF   2BNQ   2BNR   2F53   2F54   2GJ6   2P5E   2P5W   2PYE   2VLJ   2VLK   2VLR   3D39   3GSN   3O4L   3PWP   3QDG   3QDJ   3QDM   3QEQ   4JFD   4JFE   4JFF   4ZEZ   5C07   5C08   5C09   5C0A   5C0B   5C0C   5HHM   5HHO   2EYR   2EYS   2EYT   3O6F   3O8X   3O9W   3QUX   3T0E   3TVM   4C56   4MVB   4MXQ   4N0C   4N5E   4NHU   4ONH   4UDT   4UDU   4WW1   4Y16   4Y2D   4Y4F   4Y4H   4Y4K   5BRZ   5FK9   5FKA   1FYT   1J8H   1KGC   1MI5   2BNU   2CDF   2CDG   2ESV   2IAL   2IAM   2IAN   2PYF   2VLM   2XN9   2XNA   3ARB   3ARD   3ARE   3ARF   3ARG   3DX9   3DXA   3FFC   3HG1   3KPR   3KPS   3TN0   4G8E   4G8F   4JFH   4JRX   4JRY   4PRH   4PRI   4PRP   4X6B   4X6C   4X6D   4ZDH   3HE7   3QEU   3QIB   3QJF   3SCM   3SDA   3SDC   3SDD   3SJV   3SKN   4APQ   4IRS  

Gene RIF (4)

PMID Text
26400083 Folding of the TCR alpha-chain constant domain Calpha is dependent on alpha-beta heterodimerization.
21206088 Data describe two families with an autosomal recessive inherited immunodeficiency disorder characterized by increased susceptibility to infection and autoimmunity, and apparently caused by a TCRalpha subunit constant gene mutation.
20965830 Observational study of gene-disease association. (HuGE Navigator)
19470682 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

PNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKS      1 - 70
DFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLW     71 - 140
SS                                                                        141 - 142
//

Text Mined References (14)

PMID Year Title
26400083 2015 Dimerization-dependent folding underlies assembly control of the clonotypic ??T cell receptor chains.
21206088 2011 Mutation in the TCR? subunit constant gene (TRAC) leads to a human immunodeficiency disorder characterized by a lack of TCR??+ T cells.
20965830 2010 [T cell receptor constant alpha chain gene +1592C/T polymorphism may not be associated with IgA nephropathy].
19470682 2009 TRAC variants associate with IgA nephropathy.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
16079912 2005 Structure of a human autoimmune TCR bound to a myelin basic protein self-peptide and a multiple sclerosis-associated MHC class II molecule.
15489916 2004 Function of the Src-family kinases, Lck and Fyn, in T-cell development and activation.
12796775 2003 A structural basis for immunodominant human T cell receptor recognition.
12429093 2002 The 1.5 A crystal structure of a highly selected antiviral T cell receptor provides evidence for a structural basis of immunodominance.
11827988 2002 Adapters in lymphocyte signaling.
More...