Property Summary

NCBI Gene PubMed Count 47
PubMed Score 0.00
PubTator Score 4.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession P01834
Symbols Km
HCAK1
IGKCD

Gene

PDB

3BN9   3BE1   3EYQ   3BDY   3DVG   3DVN   4D3C   3IU3   3B2U   3B2V   3C09   1A4J   1A4K   1CLY   1D5B   1D5I   1D6V   1DFB   1GAF   1HEZ   1HKL   1HZH   1I7Z   1MIM   1N0X   1OM3   1OP3   1OP5   1UCB   2NY7   2O5X   2O5Y   2O5Z   2QQK   2QQL   2QQN   2QSC   2R56   2RFX   2VXQ   3BKY   3BQU   3C08   3CFJ   3CFK   3CSY   3D0L   3D85   3EYF   3EYO   3O11   3QCT   3QCU   3QCV   3RU8   3U0W   3U7W   3U7Y   3VH8   3WUW   3X11   3X12   4D9R   4HIX   4NM4   4NM8   4XMP   4XNY   4XNZ   4XXD   4YDV   5B38   5B39   5ESV   5ESZ  

Gene RIF (16)

PMID Text
24304136 Data indicate the involvement of immunoglobulin allotypes immunoglobulin gamma and kappa chains in immunity to a cancer-testis antigen, which has important implications for XAGE-1b-based immunotherapeutic interventions in lung adenocarcinoma.
24054945 genetic polymorphism is associated with immunobiology of breast cancer in Japan
23370224 IGKC gene and protein expression in human non-small cell lung cancer is associated with prognosis.IGKC is expressed in stroma-infiltrating plasma cells.
23303672 A humanized rat strain carries a chimeric human/rat IgH locus together with fully human IgL loci (variable kappas linked to Jkappa-Ckappa and Vlambdas linked to Jlambda-Clambda).
23028600 Expression of IGKC has an independent protective impact on DFS and OS in node-negative breast cancer
22351685 The findings provide IGKC as a novel diagnostic marker for risk stratification in human cancer.
21701535 Light chain proximal tubulopathy without crystal formation, despite being rarely described in the literature, is over three times more common than light chain proximal tubulopathy with crystal formation in our series.
21646814 In survivors of chronic kidney failure, median serum levels of free kappa plus lambda immunoglobulin light chains are significantly higher compared with nonsurvivors.
20870723 Glycosaminoglycan sulfation enhanced the formation of immunoglobulin light chain amyloid oligomers and fibrils.
19317746 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST      1 - 70
LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC                                       71 - 106
//

Text Mined References (51)

PMID Year Title
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
24304136 2014 Genetic variants of immunoglobulin ? and ? chains influence humoral immunity to the cancer-testis antigen XAGE-1b (GAGED2a) in patients with non-small cell lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24054945 2014 IGKC and Fc?R genotypes and humoral immunity to HER2 in breast cancer.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23370224 2013 The prognostic relevance of tumour-infiltrating plasma cells and immunoglobulin kappa C indicates an important role of the humoral immune response in non-small cell lung cancer.
23303672 2013 High-affinity IgG antibodies develop naturally in Ig-knockout rats carrying germline human IgH/Ig?/Ig? loci bearing the rat CH region.
23028600 2012 Immunoglobulin kappa C predicts overall survival in node-negative breast cancer.
More...