Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P01825 A0A0C4DH40 A0A0G2JPU1
Symbols VH
IGHV459

Gene

PDB

7FAB  

Gene RIF (1)

PMID Text
22051533 the existence of IGHV4-59 in a wide range of B-cell lymphoproliferative disorders besides CLL points to the operation of shared, pathogen-triggered, immune-mediated mechanisms

AA Sequence

MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGYI      1 - 70
YYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR                             71 - 116
//

Text Mined References (12)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22158414 2011 Molecular programming of B cell memory.
22051533 2012 Antigen receptor stereotypy across B-cell lymphoproliferations: the case of IGHV4-59/IGKV3-20 receptors with rheumatoid factor activity.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12133958 2002 Diversification of Ig heavy chain genes in human preterm neonates prematurely exposed to environmental antigens.
11340299 2001 Nomenclature of the human immunoglobulin heavy (IGH) genes.
9841928 1998 The complete nucleotide sequence of the human immunoglobulin heavy chain variable region locus.
8454861 1993 Chromosomal organization of the human VH4 gene family. Location of individual gene segments.
More...