Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession P01824 A0A0A0MS13
Symbols VH
IGHV439

Gene

PDB

1ZVO  

Gene RIF (1)

PMID Text
20471699 This study provided that IGHV4-39 deletion polymorphism does not associate with risk or outcome of multiple sclerosis.

AA Sequence

MDLMCKKMKHLWFFLLLVAAPRWVLSQLQLQESGPGLVKPSETLSLTCTVSGGSISSSSYYWGWIRQPPG      1 - 70
KGLEWIGSIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR                    71 - 125
//

Text Mined References (11)

PMID Year Title
22158414 2011 Molecular programming of B cell memory.
20471699 2010 IGHV4-39 deletion polymorphism does not associate with risk or outcome of multiple sclerosis.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
16157351 2005 Semi-extended solution structure of human myeloma immunoglobulin D determined by constrained X-ray scattering.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
11340299 2001 Nomenclature of the human immunoglobulin heavy (IGH) genes.
9841928 1998 The complete nucleotide sequence of the human immunoglobulin heavy chain variable region locus.
8454861 1993 Chromosomal organization of the human VH4 gene family. Location of individual gene segments.
6806818 1982 Complete amino acid sequence of the delta heavy chain of human immunoglobulin D.
More...