Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P01814 A0A0B4J2H3 P01815 P01816 P04438
Symbols VH
IGHV270

Gene

AA Sequence

MDILCSTLLLLTVPSWVLSQVTLRESGPALVKPTQTLTLTCTFSGFSLSTSGMCVSWIRQPPGKALEWLA      1 - 70
LIDWDDDKYYSTSLKTRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI                          71 - 119
//

Text Mined References (13)

PMID Year Title
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17947238 2008 Thermodynamic consequences of mutations in vernier zone residues of a humanized anti-human epidermal growth factor receptor murine antibody, 528.
17576170 2007 Immunoglobulin somatic hypermutation.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
11340299 2001 Nomenclature of the human immunoglobulin heavy (IGH) genes.
9841928 1998 The complete nucleotide sequence of the human immunoglobulin heavy chain variable region locus.
8247031 1993 Molecular characterization of human antibodies to bacterial antigens: utilization of the less frequently expressed VH2 and VH6 heavy chain variable region gene families.
6089186 1984 Rearranged immunoglobulin heavy chain variable region (VH) pseudogene that deletes the second complementarity-determining region.
More...