Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MELGLSWIFLLAILKGVQCEVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGI      1 - 70
SWNSGSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKD                           71 - 118
//

Text Mined References (11)

PMID Year Title