Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P01768 A0A0B4J2B7 P01769 P01770 P01773
Symbols VH
IGHV330

Gene

AA Sequence

MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVI      1 - 70
SYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK                            71 - 117
//

Text Mined References (15)

PMID Year Title
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
16860443 2006 Comparison of the human immune response to conjugate and polysaccharide pneumococcal vaccination using a reconstituted SCID mouse model.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
11340299 2001 Nomenclature of the human immunoglobulin heavy (IGH) genes.
9841928 1998 The complete nucleotide sequence of the human immunoglobulin heavy chain variable region locus.
9614934 1998 Myosin-reactive autoantibodies in rheumatic carditis and normal fetus.
6774332 1980 Amino acid sequence of the variable region of a human mu chain: location of a possible JH segment.
More...