Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVI      1 - 70
SYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK                            71 - 117
//

Text Mined References (16)

PMID Year Title