Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P01766 A0A0A0MS11
Symbols IGHV313

Gene

AA Sequence

MELGLSWVFLVAILEGVQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSAI      1 - 70
GTAGDPYYPGSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCAR                             71 - 116
//

Text Mined References (10)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
11340299 2001 Nomenclature of the human immunoglobulin heavy (IGH) genes.
3396540 1988 Content and organization of the human Ig VH locus: definition of three new VH families and linkage to the Ig CH locus.
65324 1976 Comparative studies on monotypic IgM lambda and IgG kappa from an individual patient--III. The complete amino acid sequence of the VH region of the IgM paraprotein.