Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma -2.201 0.002
osteosarcoma -2.686 0.000
chronic lymphosyte leukemia -3.000 0.000
periodontitis 2.300 0.000
medulloblastoma, large-cell -1.100 0.000
non-small cell lung cancer 1.432 0.000
colon cancer -1.500 0.039
lung cancer -2.300 0.000
interstitial cystitis 3.300 0.005
lung adenocarcinoma 1.011 0.020
ulcerative colitis 3.300 0.000
cystic fibrosis and chronic rhinosinusit... 1.073 0.008

Synonym

Accession P01764 A0A087WSX3 P01765 P01774 P01775 P01776 P01777 P01778 P01779
Symbols DP47
VH26
V3-23
IGHV323

Gene

PDB

3BN9   4KFZ   1HOU   1OHQ   3UPC   3ZHD   3ZHK   3ZHL  

AA Sequence

MEFGLSWLFLVAILKGVQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAI      1 - 70
SGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK                            71 - 117
//

Text Mined References (20)

PMID Year Title
24892548 2014 Directed evolution of human heavy chain variable domain (VH) using in vivo protein fitness filter.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
15033359 2004 Crystal structure of HEL4, a soluble, refoldable human V(H) single domain with a germ-line scaffold.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
More...