Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
chronic lymphosyte leukemia -3.000 7.0e-15
colon cancer -1.500 3.9e-02
cystic fibrosis and chronic rhinosinusit... 1.073 7.7e-03
interstitial cystitis 3.300 4.7e-03
lung adenocarcinoma 1.011 2.0e-02
lung cancer -2.300 1.4e-05
medulloblastoma, large-cell -1.100 1.4e-04
Multiple myeloma -2.201 1.7e-03
non-small cell lung cancer 1.432 1.3e-05
osteosarcoma -2.686 1.5e-06
periodontitis 2.300 4.2e-32
ulcerative colitis 3.300 6.0e-06

AA Sequence

MEFGLSWLFLVAILKGVQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAI      1 - 70
SGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK                            71 - 117
//

Text Mined References (22)

PMID Year Title