Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P01743 A0A0B4J1V4 P06326 P80421
Symbols IGHV146

Gene

Gene RIF (1)

PMID Text
24942562 Acidic amino-acid residues of IGHV1-46 are necessary and sufficient for Dsg3 binding.

AA Sequence

MDWTWRVFCLLAVAPGAHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGII      1 - 70
NPSGGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAR                            71 - 117
//

Text Mined References (10)

PMID Year Title
24942562 2014 Shared VH1-46 gene usage by pemphigus vulgaris autoantibodies indicates common humoral immune responses among patients.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
11340299 2001 Nomenclature of the human immunoglobulin heavy (IGH) genes.
7737190 1995 Characterization of the two unique human anti-flavin monoclonal immunoglobulins.
6298778 1983 Evolutionary aspects of immunoglobulin heavy chain variable region (VH) gene subgroups.
3396540 1988 Content and organization of the human Ig VH locus: definition of three new VH families and linkage to the Ig CH locus.
3084950 1986 Amino acid sequence of the variable region of heavy chain in immunoglobulin (Mot) having unusual papain cleavage sites.