Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Gene RIF (3)

AA Sequence

MDWTWRFLFVVAAATGVQSQVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGI      1 - 70
IPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCAR                            71 - 117
//

Text Mined References (23)

PMID Year Title