Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Synonym

Accession P01742 A0A0B4J1V5 P01760 P01761
Symbols IGHV1E
IGHV1-E
IGHV169

Gene

Gene RIF (3)

PMID Text
23840319 IGHV1-69-encoded antibodies bind to oxidation specific epitopes (OSE), specifically to the immunodominant OSE adduct malondialdehyde-acetaldehyde.
19220298 Observational study of gene-disease association. (HuGE Navigator)
11961170 polymorphism affects susceptibility to rheumatoid arthritis in subjects lacking the HLA-DRB1 shared epitope

AA Sequence

MDWTWRFLFVVAAATGVQSQVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGI      1 - 70
IPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCAR                            71 - 117
//

Text Mined References (22)

PMID Year Title
23840319 2013 IGHV1-69-encoded antibodies expressed in chronic lymphocytic leukemia react with malondialdehyde-acetaldehyde adduct, an immunodominant oxidation-specific epitope.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
19220298 2009 Characterization of immunoglobulin heavy and light chain gene expression in chronic lymphocytic leukemia and related disorders.
17576170 2007 Immunoglobulin somatic hypermutation.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11961170 2002 Polymorphism in the immunoglobulin VH gene V1-69 affects susceptibility to rheumatoid arthritis in subjects lacking the HLA-DRB1 shared epitope.
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
11340299 2001 Nomenclature of the human immunoglobulin heavy (IGH) genes.
More...