Knowledge Summary

Patent

No data available

AA Sequence

MLLLLVPVLEVIFTLGGTRAQSVTQLGSHVSVSEGALVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYT      1 - 70
SAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVSDLEPNSSASKIIFGSGTRLSIR          71 - 135
//

Text Mined References (2)

PMID Year Title
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
3873654 1985 Analysis of cDNA clones specific for human T cells and the alpha and beta chains of the T-cell receptor heterodimer from a human T-cell line.