Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P01733 A0A5A7
Symbols TRBV123
TCRBV8S1
TCRBV12S3

Gene

AA Sequence

MDSWTFCCVSLCILVAKHTDAGVIQSPRHEVTEMGQEVTLRCKPISGHNSLFWYRQTMMRGLELLIYFNN      1 - 70
NVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSFSTCSANYGYTFGSGTRLTVV          71 - 135
//

Text Mined References (11)

PMID Year Title
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
17652306 2007 Keeping the (kinase) party going: SLP-76 and ITK dance to the beat.
15489916 2004 Function of the Src-family kinases, Lck and Fyn, in T-cell development and activation.
12853948 2003 The DNA sequence of human chromosome 7.
11827988 2002 Adapters in lymphocyte signaling.
11048639 2000 The mechanism of phospholipase C-gamma1 regulation.
8951372 1996 Sequence and evolution of the human germline V lambda repertoire.
8650574 1996 The complete 685-kilobase DNA sequence of the human beta T cell receptor locus.
6336315 1984 A human T cell-specific cDNA clone encodes a protein having extensive homology to immunoglobulin chains.
3866244 1985 Organization and sequences of the diversity, joining, and constant region genes of the human T-cell receptor beta chain.
More...