Property Summary

NCBI Gene PubMed Count 111
Grant Count 128
R01 Count 64
Funding $23,183,746.81
PubMed Score 213.60
PubTator Score 14930.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
urothelial carcinoma -1.300 0.010
cutaneous lupus erythematosus 3.600 0.000
psoriasis 1.300 0.010
osteosarcoma -3.771 0.000
lung cancer -1.800 0.000
primary Sjogren syndrome 1.800 0.000
lung carcinoma -1.300 0.000
axial spondyloarthropathy -1.100 0.048

Synonym

Accession P01732 B4DT80 D6W5M8 Q13970 Q4ZG17
Symbols CD8
MAL
p32
Leu2

Gene

PDB

1AKJ   1CD8   1Q69   2HP4   3QZW  

Gene RIF (76)

PMID Text
26563160 missense mutation increases susceptibility to recurrent respiratory infections
26185130 Dendritic cells accumulate in the bone marrow of multiple myeloma patients and protect tumor plasma cells from CD8+ T-cell killing.
26041540 CD58/CD2 is the primary costimulatory pathway in human CD28-CD8+ T cells.
25970543 In localized colorectal cancer carriers, mRNA-based CD3Z/CD8 profiling of tumor immune response may have stage, site and tissue-specific prognostic significance, along with ESR1 expression.
25804232 Patients with the presence of CD8- and CD45RO-positive T cells in bone marrow demonstrated better survival of gastric cancer patients than those with the absence of these cells in bone marrow.
25482073 Human mesenchymal stromal cells enhance the immunomodulatory function of CD8(+)CD28(-) regulatory T cells.
24297179 CREMalpha orchestrates epigenetic remodeling of the CD8A,B through the recruitment of DNA methyltransferase (DNMT) 3a and histone methyltransferase G9a.
24104458 We suggest that unique set of interactions between CEACAM5, CD1d, and CD8 render CD1d more class I-like molecule, facilitating antigen presentation and activation of CD8(+)-suppressor regulatory T cells.
24047902 transcription factor cAMP-responsive element modulator alpha (CREMalpha), which is expressed at increased levels in T cells from systemic lupus erythematosus patients, contributes to transcriptional silencing of CD8A and CD8B.
23878500 The expression of human leucocyte antigen (HLA)-DR in epithelial cells and cluster of differentiation (CD8)-positive lymphocytes as possible markers of chronic ocular graft versus host disease, was investigated.
More...

AA Sequence

MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFL      1 - 70
LYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTT     71 - 140
PAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRN    141 - 210
RRRVCKCPRPVVKSGDKPSLSARYV                                                 211 - 235
//

Text Mined References (112)

PMID Year Title
27002170 2016 Smoothened determines ?-arrestin-mediated removal of the G protein-coupled receptor Gpr161 from the primary cilium.
26563160 2015 Recurrent Respiratory Infections Revealing CD8? Deficiency.
26185130 2015 Dendritic cells accumulate in the bone marrow of myeloma patients where they protect tumor plasma cells from CD8+ T-cell killing.
26041540 2015 CD58/CD2 Is the Primary Costimulatory Pathway in Human CD28-CD8+ T Cells.
25970543 2015 Immune response gene expression in colorectal cancer carries distinct prognostic implications according to tissue, stage and site: a prospective retrospective translational study in the context of a hellenic cooperative oncology group randomised trial.
25804232 2015 CD8 and CD45RO T lymphocytes in bone marrow of gastric cancer patients: correlation with disseminated tumor cells and disease outcome.
25482073 2015 Human mesenchymal stromal cells enhance the immunomodulatory function of CD8(+)CD28(-) regulatory T cells.
24297179 2014 cAMP responsive element modulator (CREM) ? mediates chromatin remodeling of CD8 during the generation of CD3+ CD4- CD8- T cells.
24104458 2014 Characterizing CEACAM5 interaction with CD8? and CD1d in intestinal homeostasis.
24047902 2013 cAMP-responsive element modulator ? (CREM?) trans-represses the transmembrane glycoprotein CD8 and contributes to the generation of CD3+CD4-CD8- T cells in health and disease.
More...