Property Summary

NCBI Gene PubMed Count 116
PubMed Score 222.63
PubTator Score 14930.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
axial spondyloarthropathy -1.100 4.8e-02
cutaneous lupus erythematosus 3.600 1.0e-04
lung cancer -1.800 5.1e-05
lung carcinoma -1.300 7.5e-12
osteosarcoma -3.771 1.5e-04
primary Sjogren syndrome 1.800 7.2e-05
psoriasis 1.300 9.6e-03
urothelial carcinoma -1.300 9.8e-03

 GWAS Trait (1)

Gene RIF (78)

AA Sequence

MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFL      1 - 70
LYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTT     71 - 140
PAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRN    141 - 210
RRRVCKCPRPVVKSGDKPSLSARYV                                                 211 - 235
//

Text Mined References (123)

PMID Year Title