Property Summary

Ligand Count 3
NCBI Gene PubMed Count 402
PubMed Score 407.91
PubTator Score 34698.43

Knowledge Summary


No data available


  Differential Expression (9)

Disease log2 FC p
breast carcinoma 1.100 4.5e-02
cutaneous lupus erythematosus 1.200 2.0e-02
diabetes mellitus -1.400 1.6e-02
glioblastoma 1.600 3.6e-04
invasive ductal carcinoma 1.176 4.6e-04
lung carcinoma -2.100 1.6e-27
pediatric high grade glioma 1.100 2.8e-03
Rheumatoid arthritis -1.900 3.9e-03
subependymal giant cell astrocytoma 1.362 1.9e-02

Gene RIF (1957)

AA Sequence

RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI                                    421 - 458

Text Mined References (414)

PMID Year Title