Property Summary

NCBI Gene PubMed Count 390
Grant Count 113
R01 Count 39
Funding $17,547,766.69
PubMed Score 394.52
PubTator Score 34698.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Rheumatoid Arthritis -1.900 0.004
cutaneous lupus erythematosus 1.200 0.020
glioblastoma 1.600 0.000
breast carcinoma 1.100 0.045
diabetes mellitus -1.400 0.016
pediatric high grade glioma 1.100 0.003
subependymal giant cell astrocytoma 1.362 0.019
invasive ductal carcinoma 1.176 0.000
lung carcinoma -2.100 0.000

Synonym

Accession P01730 B2R737 D3DUS5 Q4ZGK2 Q5U066 Q9UDE5
Symbols CD4mut

Gene

CD4

PDB

2JKR   2JKT   1OPN   1OPT   1OPW   3T0E   2QAD   3S4S   3S5L   1CDH   1CDI   1CDJ   1CDU   1CDY   1G9M   1G9N   1GC1   1JL4   1Q68   1RZJ   1RZK   1WBR   1WIO   1WIP   1WIQ   2B4C   2KLU   2NXY   2NXZ   2NY0   2NY1   2NY2   2NY3   2NY4   2NY5   2NY6   3B71   3CD4   3J70   3JWD   3JWO   3LQA   3O2D   4H8W   4JM2   4P9H   4Q6I   4R2G   4R4H   4RQS   5A7X   5A8H   5CAY  

Gene RIF (3215)

PMID Text
27009680 Redox shuffling of the allosteric disulfide results in previously undescribed conformational changes in CD4 that are likely important for its interaction with its protein partners.
26701340 HRB knock-down affected CD4 downregulation induced by Nef but not by HIV-1 Vpu.
26452480 Increased levels of activated and highly susceptible HIV-1 target cells, reduced CD4 and enhanced CXCR4 cell surface expression, together with the high susceptibility to FAS-induced programmed cell death may contribute to the rapid CD4+ T cell depletion.
26439863 HIV-1 Nef core domain directly interacts with CD4 and is highly conserved amongst Nef from [the] HIV-1/-2/SIV strains [tested] in 293T cells as shown by FACS-Forster resonance energy transfer (FRET)- and site-directed mutagenesis-based experiments
26439863 HIV-1 Nef core domain directly interacts with CD4 and is highly conserved amongst Nef from [the] HIV-1/-2/SIV strains [tested] in 293T cells as shown by FACS-Forster resonance energy transfer (FRET)- and site-directed mutagenesis-based experiments
26432024 CD4 receptor induced HIV size expansion prior to cell entry.
26423947 HIV-1 Nef core domain directly interacts with CD4 and is highly conserved amongst Nef from [the] HIV-1/-2/SIV strains [tested] in 293T cells as shown by FACS-Forster resonance energy transfer (FRET)- and site-directed mutagenesis-based experiments
26423947 HIV-1 Nef core domain directly interacts with CD4 and is highly conserved amongst Nef from [the] HIV-1/-2/SIV strains [tested] in 293T cells as shown by FACS-Forster resonance energy transfer (FRET)- and site-directed mutagenesis-based experiments
26423947 HIV-1 Nef core domain directly interacts with CD4 and is highly conserved amongst Nef from [the] HIV-1/-2/SIV strains [tested] in 293T cells as shown by FACS-Forster resonance energy transfer (FRET)- and site-directed mutagenesis-based experiments
26381025 Increased CD4, IL-17, and COX-2 expression are associated with subclinical inflammation in malar melasma.
More...

AA Sequence

MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLT      1 - 70
KGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLT     71 - 140
LTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSI    141 - 210
VYKKEGEQVEFSFPLAFTVEKLTGSGELWWQAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPL    211 - 280
HLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAK    281 - 350
VSKREKAVWVLNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCV    351 - 420
RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI                                    421 - 458
//

Text Mined References (396)

PMID Year Title
27009680 2016 Human CD4 Metastability Is a Function of the Allosteric Disulfide Bond in Domain 2.
26701340 2016 The human immunodeficiency virus (HIV) Rev-binding protein (HRB) is a co-factor for HIV-1 Nef-mediated CD4 downregulation.
26452480 2015 Increased susceptibility of CD4+ T cells from elderly individuals to HIV-1 infection and apoptosis is associated with reduced CD4 and enhanced CXCR4 and FAS surface expression levels.
26432024 2015 Cryo-electron microscopy and single molecule fluorescent microscopy detect CD4 receptor induced HIV size expansion prior to cell entry.
26381025 2015 CD4, IL-17, and COX-2 Are Associated With Subclinical Inflammation in Malar Melasma.
26362701 2016 The role of CD4 on mechanical properties of live cell membrane.
26333292 2015 Decrease of CD4(+) CD25(+) CD127(low) FoxP3(+) regulatory T cells with impaired suppressive function in untreated ulcerative colitis patients.
26205220 2015 T-cell receptor activation of human CD4(+) T cells shifts the innate TLR response from CXCL8(hi) IFN-?(null) to CXCL8(lo) IFN-?(hi).
25997495 2015 Continuous expression of CD83 on activated human CD4? T cells is correlated with their differentiation into induced regulatory T cells.
25979195 Identification of therapeutic targets for childhood severe asthmatics with DNA microarray.
More...