Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma 2.000 3.3e-12
mucosa-associated lymphoid tissue lympho... 2.161 1.3e-02
non-small cell lung carcinoma 1.800 2.6e-14

AA Sequence

MAWAPLLLTLLAHCTGSWANFMLTQPHSVSESPGKTVTISCTGSSGSIASNYVQWYQQRPGSAPTTVIYE      1 - 70
DNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSN                            71 - 117
//

Text Mined References (17)

PMID Year Title