Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Synonym

Accession P01718 A0A075B6J3
Symbols V2-19
IGLV327

Gene

AA Sequence

MAWIPLLLPLLILCTVSVASYELTQPSSVSVSPGQTARITCSGDVLAKKYARWFQQKPGQAPVLVIYKDS      1 - 70
ERPSGIPERFSGSSSGTTVTLTISGAQVEDEADYYCYSAADNN                                71 - 113
//

Text Mined References (10)

PMID Year Title
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
11872955 2001 Nomenclature of the human immunoglobulin lambda (IGL) genes.
10591208 1999 The DNA sequence of human chromosome 22.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
5549568 1971 [Structural rule of antibodies. Primary structure of a monoclonal immunoglobulin-L-chain of the lambda type, subgroup IV (Bence-Jones-protein Kern). V. The complete amino acid sequence and its genetic interpretation].
1249422 1976 Activation of C1r by proteolytic cleavage.
814163 1976 Physicochemical and functional characterization of the C1r subunit of the first complement component.