Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 4.1e-03

AA Sequence

MAWIPLLLPLLILCTVSVASYELTQPSSVSVSPGQTARITCSGDVLAKKYARWFQQKPGQAPVLVIYKDS      1 - 70
ERPSGIPERFSGSSSGTTVTLTISGAQVEDEADYYCYSAADNN                                71 - 113
//

Text Mined References (11)

PMID Year Title