Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma -2.868 0.004
cutaneous lupus erythematosus 2.900 0.032
psoriasis -1.100 0.038
osteosarcoma -5.781 0.000
chronic lymphosyte leukemia -1.600 0.006
periodontitis 2.200 0.000
tuberculosis 1.200 0.007
non-small cell lung cancer 1.022 0.006
lung cancer -1.500 0.000
interstitial cystitis 3.300 0.005
ulcerative colitis 3.400 0.000
Chronic obstructive pulmonary disease -1.100 0.029

Synonym

Accession P01717 A0A075B6J4
Symbols V2-17
IGLV325

Gene

AA Sequence

MAWIPLLLPLLTLCTGSEASYELTQPPSVSVSPGQTARITCSGDALPKQYAYWYQQKPGQAPVLVIYKDS      1 - 70
ERPSGIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSADSS                                 71 - 112
//

Text Mined References (14)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
11872955 2001 Nomenclature of the human immunoglobulin lambda (IGL) genes.
10591208 1999 The DNA sequence of human chromosome 22.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
More...