Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
chronic lymphosyte leukemia -1.600 6.2e-03
Chronic obstructive pulmonary disease -1.100 2.9e-02
cutaneous lupus erythematosus 2.900 3.2e-02
interstitial cystitis 2.600 4.6e-02
lung cancer -1.500 3.7e-05
Multiple myeloma -2.868 4.0e-03
non-small cell lung cancer 1.022 5.8e-03
osteosarcoma -5.781 5.6e-15
periodontitis 2.200 6.6e-27
psoriasis -1.100 3.8e-02
tuberculosis 1.200 6.5e-03
ulcerative colitis 3.400 1.8e-04

AA Sequence

MAWIPLLLPLLTLCTGSEASYELTQPPSVSVSPGQTARITCSGDALPKQYAYWYQQKPGQAPVLVIYKDS      1 - 70
ERPSGIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSADSS                                 71 - 112
//

Text Mined References (15)

PMID Year Title