Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MAWIPLFLGVLAYCTGSVASYELTQPPSVSVSPGQTASITCSGDKLGDKYACWYQQKPGQSPVLVIYQDS      1 - 70
KRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAH                              71 - 115
//

Text Mined References (10)

PMID Year Title