Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P01715 A0A075B6K7 P01716 P06889
Symbols V2-1
IGLV31

Gene

AA Sequence

MAWIPLFLGVLAYCTGSVASYELTQPPSVSVSPGQTASITCSGDKLGDKYACWYQQKPGQSPVLVIYQDS      1 - 70
KRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAH                              71 - 115
//

Text Mined References (9)

PMID Year Title
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
11872955 2001 Nomenclature of the human immunoglobulin lambda (IGL) genes.
10591208 1999 The DNA sequence of human chromosome 22.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
4883841 1968 Immunoglobulin lambda-chains. The complete amino acid sequence of a Bence-Jones protein.
4435717 1974 [Pattern of antibody structure, the primary structure of monoclonal immunoglobulin L-chain of the lambda-type, subgroup IV (Bence-Jones protein Bau.) (author's transl)].
3103603 1986 Structural studies of a carbohydrate-containing immunoglobulin-lambda-light-chain amyloid-fibril protein (AL) of variable subgroup III.