Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma -1.696 0.041
osteosarcoma -5.053 0.000
chronic lymphosyte leukemia -2.000 0.000
periodontitis 2.400 0.000
tuberculosis 1.600 0.003
lung cancer -1.300 0.000
interstitial cystitis 4.600 0.000
invasive ductal carcinoma 2.061 0.008
ulcerative colitis 3.100 0.000
ovarian cancer 1.400 0.000

Synonym

Accession P01714 A0A075B6J8
Symbols VL3L
V2-13
IGLV319

Gene

AA Sequence

MAWTPLWLTLLTLCIGSVVSSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKN      1 - 70
NRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSRDSS                                 71 - 112
//

Text Mined References (10)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
11872955 2001 Nomenclature of the human immunoglobulin lambda (IGL) genes.
10591208 1999 The DNA sequence of human chromosome 22.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
4909564 1970 The amino acid sequence of a lambda type Bence-Jones protein. 3. The complete amino acid sequence and the location of the disulfide bridges.
2124677 1990 First genomic sequence of a human Ig variable lambda gene belonging to subgroup III.