Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
chronic lymphosyte leukemia -2.000 8.9e-07
interstitial cystitis 3.100 6.6e-03
invasive ductal carcinoma 2.061 7.7e-03
lung cancer -1.300 4.8e-04
Multiple myeloma -1.696 4.1e-02
osteosarcoma -5.053 1.9e-14
ovarian cancer 1.400 5.4e-10
periodontitis 2.400 1.3e-31
tuberculosis 1.600 3.3e-03
ulcerative colitis 3.100 3.6e-05

AA Sequence

MAWTPLWLTLLTLCIGSVVSSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKN      1 - 70
NRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSRDSS                                 71 - 112
//

Text Mined References (11)

PMID Year Title