Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 0.11

Knowledge Summary

Patent

No data available

Synonym

Accession P01709 A0A087WZW9 P01710
Symbols V1-2
IGLV28

Gene

PDB

1A8J   1DCL   1MCW   2MCG   3MCG   4UNT   4UNU   4UNV   5ACL   5ACM  

AA Sequence

MAWALLLLTLLTQGTGSWAQSALTQPPSASGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIY      1 - 70
EVSKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYAGSNNF                           71 - 118
//

Text Mined References (10)

PMID Year Title
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
11872955 2001 Nomenclature of the human immunoglobulin lambda (IGL) genes.
10591208 1999 The DNA sequence of human chromosome 22.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
8951372 1996 Sequence and evolution of the human germline V lambda repertoire.
5532228 1970 Amino acid sequence of human lambda chains. 3. Tryptic peptides, chymotryptic peptides, and sequence of protein Bo.
4415202 1974 Primary structure of the Mcg lambda chain.
2515285 1989 Three-dimensional structure of a light chain dimer crystallized in water. Conformational flexibility of a molecule in two crystal forms.