Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 0.001

Synonym

Accession P01706 A0A075B6K3 P01707 P01708 P01712 P01713 P80422
Symbols V1-3
IGLV211

Gene

AA Sequence

MAWALLLLSLLTQGTGSWAQSALTQPRSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIY      1 - 70
DVSKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYTFH                          71 - 119
//

Text Mined References (17)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
11872955 2001 Nomenclature of the human immunoglobulin lambda (IGL) genes.
10591208 1999 The DNA sequence of human chromosome 22.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
8951372 1996 Sequence and evolution of the human germline V lambda repertoire.
7737190 1995 Characterization of the two unique human anti-flavin monoclonal immunoglobulins.
More...