Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P01705 A0A075B6J5
Symbols V1-7
IGLV223

Gene

AA Sequence

MAWALLLLTLLTQDTGSWAQSALTQPASVSGSPGQSITISCTGTSSDVGSYNLVSWYQQHPGKAPKLMIY      1 - 70
EGSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYA                                71 - 113
//

Text Mined References (11)

PMID Year Title
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
11872955 2001 Nomenclature of the human immunoglobulin lambda (IGL) genes.
10591208 1999 The DNA sequence of human chromosome 22.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
5043326 1972 The primary structure of a monoclonal human lambda-type immunoglobulin L-chain of subgroup II (Bence-Jones protein NEI).
2499872 1989 First nucleotide sequence of a human immunoglobulin variable lambda gene belonging to subgroup II.
1249422 1976 Activation of C1r by proteolytic cleavage.
More...