Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P01703 A0A075B6J0
Symbols V1-13
IGLV140

Gene

AA Sequence

MAWSPLLLTLLAHCTGSWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIY      1 - 70
GNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSG                           71 - 118
//

Text Mined References (11)

PMID Year Title
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
11872955 2001 Nomenclature of the human immunoglobulin lambda (IGL) genes.
10591208 1999 The DNA sequence of human chromosome 22.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
4814727 1974 Amino acid sequence of the (lambda) light chain of a human myeloma immunoglobulin (IgG New).
1495496 1992 Molecular characterization of the human immunoglobulin V lambda I germline gene repertoire.
1249422 1976 Activation of C1r by proteolytic cleavage.
More...