Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P01699 A0A0B4J1U1 A0A0G2JQC2 A0A0U1RVH6 P06887
Symbols V1-16
IGLV144

Gene

AA Sequence

MASFPLLLTLLTHCAGSWAQSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYS      1 - 70
NNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNG                            71 - 117
//

Text Mined References (14)

PMID Year Title
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
11872955 2001 Nomenclature of the human immunoglobulin lambda (IGL) genes.
10591208 1999 The DNA sequence of human chromosome 22.
9712075 1998 Molecular analysis of polyreactive monoclonal antibodies from rheumatic carditis: human anti-N-acetylglucosamine/anti-myosin antibody V region genes.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
8951372 1996 Sequence and evolution of the human germline V lambda repertoire.
More...