Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P01614 A0A075B6R1
Symbols O1
IGKV2D40

Gene

AA Sequence

MRLPAQLLGLLMLWVPGSSEDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSP      1 - 70
QLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQRIEFP                        71 - 121
//

Text Mined References (9)

PMID Year Title
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
11549845 2001 Nomenclature of the human immunoglobulin kappa (IGK) genes.
11298326 2001 Evolutionary dynamics of the human immunoglobulin kappa locus and the germline repertoire of the Vkappa genes.
5586923 1967 [The complete amino acid sequence of Bence Jones protein Cum (kappa-type)].
4188189 1969 [Molecular basis of antibody formation].
1907917 1991 The human immunoglobulin kappa locus. Characterization of the duplicated O regions.