Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 2.50

Knowledge Summary

Patent

No data available

AA Sequence

MDMRVPAQLLGLLLLWLPGAKCDIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLI      1 - 70
YKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNSYS                            71 - 117
//

Text Mined References (20)

PMID Year Title