Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P01602 A0A075B6S8 P01596 P01598 P01604
Symbols V1
L12
IGKV
L12a
IGKV15

Gene

AA Sequence

MDMRVPAQLLGLLLLWLPGAKCDIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLI      1 - 70
YKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNSYS                            71 - 117
//

Text Mined References (19)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
11549845 2001 Nomenclature of the human immunoglobulin kappa (IGK) genes.
More...