Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Synonym

Accession P01599 A0A0B4J1Z4 P01610
Symbols A30
IGKV117

Gene

AA Sequence

MDMRVPAQLLGLLLLWFPGARCDIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLI      1 - 70
YAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYP                            71 - 117
//

Text Mined References (10)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
11549845 2001 Nomenclature of the human immunoglobulin kappa (IGK) genes.
8223863 1993 The V kappa genes of the L regions and the repertoire of V kappa gene sequences in the human germ line.
6410398 1983 Amino acid sequence of the Fv region of a human monoclonal IgM (protein WEA) with antibody activity against 3,4-pyruvylated galactose in Klebsiella polysaccharides K30 and K33.
4215718 [The primary structure of a monoclonal IgM-immunoglobulin (macroglobulin Gal.), I. The amino acid sequence of the L-chain of kappa-type, subgroup I (author's transl)].