Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 0.033

Synonym

Accession P01597 A0A0B4J1Z7 A0A0C4DH57 A0A0U1RVJ5 P01600 P01606 P01612 P04431
Symbols O12
O12a
IGKV139

Gene

PDB

1DGX   1F6L   3UPA  

AA Sequence

MDMRVPAQLLGLLLLWLRGARCDIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLI      1 - 70
YAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTP                            71 - 117
//

Text Mined References (18)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
17576170 2007 Immunoglobulin somatic hypermutation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12217656 2002 Antiferritin VL homodimer binds human spleen ferritin with high specificity.
More...