Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

AA Sequence

MDMRVPAQLLGLLLLWLSGARCDIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLI      1 - 70
YDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDNLP                            71 - 117
//

Text Mined References (11)

PMID Year Title