Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession P01594 A0A087WZH9 P01603
Symbols O18
IGKV133

Gene

PDB

1B0W   1JV5   1QP1   2Q20   3CDC   3CDF   3CDY   4K07  

AA Sequence

MDMRVPAQLLGLLLLWLSGARCDIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLI      1 - 70
YDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDNLP                            71 - 117
//

Text Mined References (10)

PMID Year Title
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12379775 2002 Antibodies to acetylcholine receptor in parous women with myasthenia: evidence for immunization by fetal antigen.
11549845 2001 Nomenclature of the human immunoglobulin kappa (IGK) genes.
5028201 1972 [Rule of antibody structure. The primary structure of a monoclonal immunoglobulin L-chain of the kappa-type, subgroup I (Bence-Jones protein Au)].
1940382 1991 Clonal characterization of the human IgG antibody repertoire to Haemophilus influenzae type b polysaccharide. IV. The less frequently expressed VL are heterogeneous.
1234024 1975 The structure determination of the variable portion of the Bence-Jones protein Au.
818073 1975 Comparative structural studies on the light chains of human immunoglobulins. I. Protein Ka with the Inv(3) allotypic marker.