Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P01593 A0A0B4J1U0 P01595 P01605 P01607 P01608 P01609 P01613 P80362
Symbols O8
IGKV1D33

Gene

PDB

1AR2   1BWW   1REI   1WTL   4L1H  

AA Sequence

MDMRVPAQLLGLLLLWLSGARCDIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLI      1 - 70
YDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDNLP                            71 - 117
//

Text Mined References (27)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
11549845 2001 Nomenclature of the human immunoglobulin kappa (IGK) genes.
11298326 2001 Evolutionary dynamics of the human immunoglobulin kappa locus and the germline repertoire of the Vkappa genes.
More...