Property Summary

Ligand Count 4
NCBI Gene PubMed Count 464
PubMed Score 927.80
PubTator Score 3528.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (10)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Graves' disease 24 0.0 5.0
Disease Target Count Z-score Confidence
diabetes mellitus 1728 3.418 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 1.5e-03
glioblastoma 1.300 3.7e-03
interstitial cystitis 1.300 1.9e-03
lung adenocarcinoma 1.300 5.7e-09
medulloblastoma, large-cell 1.500 4.8e-05
non-small cell lung carcinoma 1.200 1.7e-14
ovarian cancer 1.500 3.8e-08
psoriasis 1.100 5.4e-04

 CSPA Cell Line (2)

Protein-protein Interaction (1)

Gene RIF (421)

AA Sequence

MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGN      1 - 70
SSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIY     71 - 140
HFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQLICTGEMETSQFPGEEKPQASPEGRPESE    141 - 210
TSCLVTTTDFQIQTEMAATMETSIFTTEYQVAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI            211 - 272
//

Text Mined References (465)

PMID Year Title