Property Summary

NCBI Gene PubMed Count 329
Grant Count 1,402
R01 Count 635
Funding $214,423,964.21
PubMed Score 8755.76
PubTator Score 14631.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (70)

Disease Z-score Confidence
Anemia 252 8.365 4.0
Kidney failure 39 6.947 3.5
Polycythemia 19 6.328 3.2
Cancer 2,346 5.417 2.7
Hypertension 287 4.713 2.4
Cerebrovascular disease 231 4.515 2.3
Thalassemia 46 4.153 2.1
diabetes mellitus 1,663 4.087 2.0
Neutropenia 78 4.059 2.0
Myocardial Infarction 126 4.028 2.0
Hyperparathyroidism 43 3.959 2.0
Thrombocytopenia 105 3.922 2.0
Retinopathy of prematurity 21 3.908 2.0
Heart disease 279 3.647 1.8
Diabetic Retinopathy 53 3.402 1.7
Hepatitis C 90 3.349 1.7
Nutrition disease 2 3.277 1.6
Proteinuria 63 3.212 1.6
Acquired immunodeficiency syndrome 164 3.197 1.6
Brain disease 83 3.196 1.6
Sickle cell anemia 35 3.131 1.6
Liver disease 219 3.077 1.5
Malaria 140 3.061 1.5
Neurodegenerative disease 383 3.054 1.5
Autonomic neuropathy 21 3.045 1.5
Acute kidney injury 65
Anemia, Hemolytic 12
Beta thalassemia 19
CNS disorder 3
Calcinosis 62
Cardiomyopathies 90
Cognition Disorders 23
Coronary artery disease 240
Crohn's disease 304 2.0
Experimental Autoimmune Encephalomyeliti... 7 
Fatigue 4
Gastric ulcer 34
Heart Diseases 42
Hypertensive disease 193
Inflammation 109
Kidney Diseases 86
Kidney Failure, Chronic 45
MICROVASCULAR COMPLICATIONS OF DIABETES,... 1 
MYELODYSPLASTIC SYNDROME 36
Melanoma 261
Neoplasm Invasiveness 127
Neoplasm Metastasis 138
Nerve Degeneration 73
Neurodegenerative Disorders 37
Pancytopenia 9
Polyneuropathy 30
Pulmonary Embolism 45
Renal Insufficiency 10
Sarcoma, Experimental 1
Shock, Cardiogenic 3
Status Epilepticus 85
Tachycardia, Ventricular 10
Thrombosis 42
Thyroid Neoplasm 33
Uremia 19
Vascular Diseases 16
Venous Thrombosis 21
Ventricular Fibrillation 10
Ventricular Septal Defects 2
Weight decreased 18
atypical teratoid / rhabdoid tumor 4,369
glioblastoma 5,572
hemolytic-uremic syndrome 28
medulloblastoma, large-cell 6,234
ovarian cancer 8,484

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.200 0.000
ovarian cancer -1.400 0.000

Synonym

Accession P01588 Q2M2L6 Q549U2 Q9UDZ0 Q9UEZ5 Q9UHA0
Symbols EP
MVCD2

Gene

EPO

PANTHER Protein Class (2)

PDB

1BUY   1CN4   1EER  

Gene RIF (300)

PMID Text
27081163 Suggest that hypoxia prevents EPO suppression, and exaggerates the plasma volume reduction induced by bed rest.
26995951 The review describes the induction of erythropoietin gene expression in liver, reproouctive and hemopoietic systems during hypoxia or a state of proliferation.
26838000 Conclusion: Anemia in cancers was not because of inadequate Epo or Fe levels, but because of improper Epo response.
26721912 Higher levels of endogenous erythropoietin are associated with incident heart failure in older adults.
26469975 Erythropoietin protects mouse renal tubular basement membrane by promoting bone marrow cells to generate and secrete miR-144, which, in turn, inhibits activation of the tPA/MMP9-mediated proteolytic network.
26447159 Data suggest maternal circulating 25-hydroxyvitamin D during mid-pregnancy and at delivery is inversely related to serum EPO; an indirect relation observed between circulating vitamin D and circulating hemoglobin is at least partly mediated by EPO.
26412593 Our findings have important potential clinical implications, indicating that EPO supplementation in rhabdomyosarcoma patients may have the unwanted side effect of tumor progression.
26261574 suggest that rhEPO regulates apoptosis-related genes and affects apoptosis in the hippocampus of aging rats by upregulating SIRT.
26097591 In multivariate survival analysis, age, Epo and EpoR were independent prognostic factors related to overall survival in hepatocellular carcinoma.
26049959 Inadequate erythropoietin response may partly explain anemia in anorexia nervosa.
More...

AA Sequence

MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPD      1 - 70
TKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALG     71 - 140
AQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR                     141 - 193
//

Text Mined References (331)

PMID Year Title
27081163 2016 PlanHab: Hypoxia counteracts the erythropoietin suppression, but seems to exaggerate the plasma volume reduction induced by 3 weeks of bed rest.
26995951 2015 [REGULATION OF EXTRARENAL ERYTHROPOIETIN PRODUCTION].
26838000 A study on biochemical facet of anemia in cancers: A strong link between erythropoietin and tumor necrosis factor alpha in anemic cancer patients.
26721912 2016 Association of Serum Erythropoietin With Cardiovascular Events, Kidney Function Decline, and Mortality: The Health Aging and Body Composition Study.
26469975 2016 Erythropoietin protects the tubular basement membrane by promoting the bone marrow to release extracellular vesicles containing tPA-targeting miR-144.
26447159 2015 Vitamin D status is inversely associated with anemia and serum erythropoietin during pregnancy.
26412593 2015 Human rhabdomyosarcoma cells express functional erythropoietin receptor: Potential therapeutic implications.
26261574 2015 rhEPO affects apoptosis in hippocampus of aging rats by upregulating SIRT1.
26097591 2015 Erythropoietin and erythropoietin receptor in hepatocellular carcinoma: correlation with vasculogenic mimicry and poor prognosis.
26049959 2015 [Blunted erythropoietic response in the anemia of anorexia nervosa].
More...