Property Summary

NCBI Gene PubMed Count 361
PubMed Score 8985.55
PubTator Score 14631.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Anemia 365 8.384 4.0
Hypertension 396 4.762 2.4
Myocardial Infarction 151 4.054 2.0
Thrombocytopenia 197 3.954 2.0
Acute kidney injury 70 0.0 0.0
Anemia, Hemolytic 55 0.0 0.0
Brain Injuries 65 0.0 0.0
Calcinosis 70 0.0 0.0
Cardiomyopathies 110 0.0 0.0
Central Nervous System Diseases 4 0.0 0.0
Cognition Disorders 32 0.0 0.0
Coronary artery disease 268 0.0 0.0
Encephalomyelitis, Autoimmune, Experimental 8 0.0 0.0
Fatigue 182 0.0 0.0
Heart Diseases 43 0.0 0.0
Heart Septal Defects, Ventricular 6 0.0 0.0
Hemolytic-Uremic Syndrome 30 0.0 0.0
Hernias, Diaphragmatic, Congenital 17 0.0 0.0
Inflammation 120 0.0 0.0
Kidney Diseases 114 0.0 0.0
Kidney Failure, Chronic 46 0.0 0.0
MICROVASCULAR COMPLICATIONS OF DIABETES, SUSCEPTIBILITY TO, 2 1 0.0 0.0
Melanoma 711 0.0 0.0
Myelodysplastic Syndromes 26 0.0 0.0
Neoplasm Invasiveness 161 0.0 0.0
Neoplasm Metastasis 168 0.0 0.0
Nerve Degeneration 121 0.0 0.0
Neurodegenerative Diseases 38 0.0 0.0
Pancytopenia 45 0.0 0.0
Paraneoplastic Syndromes 1 0.0 0.0
Poisoning 16 0.0 0.0
Polyneuropathies 3 0.0 0.0
Pulmonary embolism 55 0.0 0.0
Renal Insufficiency 90 0.0 0.0
Sarcoma, Experimental 1 0.0 0.0
Shock, Cardiogenic 3 0.0 0.0
Status Epilepticus 98 0.0 0.0
Stomach Ulcer 18 0.0 0.0
Tachycardia, Ventricular 22 0.0 0.0
Thrombosis 46 0.0 0.0
Thyroid Neoplasms 34 0.0 0.0
Uremia 19 0.0 0.0
Vascular Diseases 16 0.0 0.0
Venous Thrombosis 47 0.0 0.0
Ventricular Fibrillation 17 0.0 0.0
Weight Loss 24 0.0 0.0
beta-Thalassemia 10 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 3.3e-07
atypical teratoid / rhabdoid tumor 5112 1.1e-06
glioblastoma 5792 1.9e-04
medulloblastoma, large-cell 6241 2.5e-04
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 1.1e-06
glioblastoma -1.200 1.9e-04
medulloblastoma, large-cell -1.200 2.5e-04
ovarian cancer -1.400 3.3e-07

Protein-protein Interaction (6)

Gene RIF (328)

AA Sequence

MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPD      1 - 70
TKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALG     71 - 140
AQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR                     141 - 193
//

Text Mined References (363)

PMID Year Title