Property Summary

NCBI Gene PubMed Count 810
PubMed Score 3644.81
PubTator Score 6881.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
tuberculosis 1563 2.40269879140377E-11
lung carcinoma 2844 9.26090652686276E-9
malignant mesothelioma 3163 1.54578971950662E-8
lung cancer 4473 9.09664605871696E-5
ulcerative colitis 2087 3.20773532508621E-4
cystic fibrosis 1670 3.56118252656083E-4
cutaneous lupus erythematosus 1056 0.0109399353372073
oligodendroglioma 2849 0.026742055010637
Disease Target Count Z-score Confidence
Endometriosis 535 0.0 1.0
Schizophrenia 503 0.0 1.0
Disease Target Count Z-score Confidence
Ankylosing spondylitis 138 0.0 5.0

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -3.500 0.000
oligodendroglioma -1.100 0.027
cutaneous lupus erythematosus 1.800 0.011
cystic fibrosis 1.683 0.000
tuberculosis -7.300 0.000
lung cancer -1.500 0.000
lung carcinoma -1.900 0.000
ulcerative colitis 2.500 0.000

Synonym

Accession P01583 Q53QF9 Q7RU02 IL-1 alpha
Symbols IL1
IL-1A
IL1F1
IL1-ALPHA

Gene

PDB

1ITA   2ILA   2KKI   2L5X  

  Ortholog (9)

Gene RIF (881)

PMID Text
27078871 The study investigates Il-1 gene cluster polymorphisms and their association with coronary artery disease. Significant differences in association statuses were seen for IL1A +4845 G>T, IL1B -511 C>T.
26909967 A functional insertion/deletion polymorphism in the IL1A gene is associated with decreased risk of breast cancer.
26909953 IL-1A rs17561 and IL-1B rs1143634 polymorphisms are associated with periodontitis.
26879815 Reported is the distribution of allelic and genotypic frequencies of IL1A, IL4, NFKB1 and PAR1 variants in Native American, African, and European populations of Brazil and their association with predisposition to cancer.
26808616 Inactivation of the EGFR with a blocking antibody decreased the S. aureus-mediated IL-1alpha induction in primary keratinocytes. Inflammasomes mediate induced secretion but not induced gene expression of IL-1alpha.
26728383 Data show that the expressions of interleukins IL-1 and IL-6 in the discs of discogenic low back pain (DLBP) patients were significantly elevated and negatively correlated with the Japanese Orthopedic Association (mJOA) scores of low back pain.
26506473 Lung tumor-associated plasmacytoid dendritic cells (pDCs) are responsive to the activation of AIM2 that promotes calcium efflux and reactive oxygen species from mitochondria, leading to calpain activation and high levels of IL-1alpha.
26460957 Report a significant relationship between IL-1alpha expression and development of distant metastasis in head and neck squamous cell carcinoma patients.
26381575 Letter: Knockdown of either filaggrin or loricrin increases the productions of interleukin (IL)-1alpha, IL-8, IL-18 and granulocyte macrophage colony-stimulating factor in stratified human keratinocytes.
26380303 Patients with better muscle function had the highest concentration of CK, IL-1, and TNF-a compared with less muscle function
More...

AA Sequence

MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETSKTSKLTFKES      1 - 70
MVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLSNVKYNFMRIIKYEFILNDAL     71 - 140
NQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEI    141 - 210
PKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA             211 - 271
//

Text Mined References (812)

PMID Year Title
27078871 2016 Interleukin-1 Gene Cluster Polymorphisms and Their Association with Coronary Artery Disease: Separate Evidences from the Largest Case-Control Study amongst North Indians and an Updated Meta-Analysis.
26909967 2016 A functional insertion/deletion polymorphism in the IL1A gene is associated with decreased risk of breast cancer.
26909953 2016 Association between IL-1? rs17561 and IL-1? rs1143634 polymorphisms and periodontitis: a meta-analysis.
26879815 2016 Distribution of allelic and genotypic frequencies of IL1A, IL4, NFKB1 and PAR1 variants in Native American, African, European and Brazilian populations.
26808616 2016 The Inflammasome and the Epidermal Growth Factor Receptor (EGFR) Are Involved in the Staphylococcus aureus-Mediated Induction of IL-1alpha and IL-1beta in Human Keratinocytes.
26728383 2016 [Increased IL-1 and IL-6 expressions are negatively correlated with modified Japanese Orthopedic Association (mJOA) scores of discogenic low back pain].
26506473 2015 Human lung cancer-derived immunosuppressive plasmacytoid dendritic cells release IL-1? in an AIM2 inflammasome-dependent manner.
26460957 2015 Expression of IL-1? correlates with distant metastasis in patients with head and neck squamous cell carcinoma.
26381575 2015 Knockdown of either filaggrin or loricrin increases the productions of interleukin (IL)-1?, IL-8, IL-18 and granulocyte macrophage colony-stimulating factor in stratified human keratinocytes.
26380303 2015 Systemic Inflammation in Duchenne Muscular Dystrophy: Association with Muscle Function and Nutritional Status.
More...