1. Home
  2. Targets
  3. Interferon gamma

Tbio Interferon gamma

Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.

This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. [provided by RefSeq, Dec 2015]

 Comments

Property Summary

NCBI Gene PubMed Count 1,643
PubMed Score 5727.43
PubTator Score 15643.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Multiple Sclerosis 540 5.185 2.6
Leishmaniasis 47 4.728 2.4
Hepatitis B 108 4.436 2.2
Hepatitis C 94 4.174 2.1
Atherosclerosis 291 4.024 2.0
Acquired immunodeficiency syndrome 197 0.0 0.0
Adrenoleukodystrophy 29 0.0 0.0
Anemia, Aplastic 7 0.0 0.0
Appendicitis 15 0.0 0.0
Arsenic Poisoning 62 0.0 0.0
Arthritis, Experimental 39 0.0 0.0
Arthritis, Infectious 3 0.0 0.0
Arthritis, Rheumatoid 174 0.0 0.0
Autistic Disorder 364 0.0 0.0
Autoimmune Diseases 67 0.0 0.0
Brain Diseases 24 0.0 0.0
Breast Neoplasms 445 0.0 0.0
Bronchiolitis Obliterans 4 0.0 0.0
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Chills 2 0.0 0.0
Chlamydia Infections 2 0.0 0.0
Colitis 54 0.0 0.0
Colonic Neoplasms 142 0.0 0.0
Crohn Disease 45 0.0 0.0
Dermatitis, Allergic Contact 67 0.0 0.0
Dermatitis, Atopic 37 0.0 0.0
Diabetes Mellitus, Experimental 108 0.0 0.0
Diabetes Mellitus, Type 1 43 0.0 0.0
Disease Models, Animal 155 0.0 0.0
Entamoebiasis 6 0.0 0.0
Eyelid Diseases 2 0.0 0.0
Fever 138 0.0 0.0
Glomerulonephritis 46 0.0 0.0
Graft vs Host Disease 6 0.0 0.0
HIV Infections 102 0.0 0.0
Heart Arrest 3 0.0 0.0
Heart failure 162 0.0 0.0
Hepatitis 67 0.0 0.0
Hepatitis, Autoimmune 17 0.0 0.0
Hypersensitivity 63 0.0 0.0
Hyponatremia 25 0.0 0.0
Hypotension 82 0.0 0.0
Immune Complex Diseases 3 0.0 0.0
Inflammation 120 0.0 0.0
Job Syndrome 3 0.0 0.0
Legionnaires' disease 20 0.0 0.0
Leishmaniasis, Cutaneous 8 0.0 0.0
Leishmaniasis, Mucocutaneous 1 0.0 0.0
Leishmaniasis, Visceral 13 0.0 0.0
Leukemia, Promyelocytic, Acute 36 0.0 0.0
Leukemia-Lymphoma, Adult T-Cell 30 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Lung Neoplasms 232 0.0 0.0
Lymphoproliferative Disorders 6 0.0 0.0
MYCOBACTERIUM TUBERCULOSIS, SUSCEPTIBILITY TO 11 0.0 0.0
Manganese Poisoning 11 0.0 0.0
Melanoma 711 0.0 0.0
Mesothelioma 38 0.0 0.0
Mesothelioma, Malignant 105 0.0 0.0
Nausea 20 0.0 0.0
Necrosis 53 0.0 0.0
Neoplasms, Experimental 40 0.0 0.0
Nerve Degeneration 121 0.0 0.0
Neural Tube Defects 31 0.0 0.0
Oral Submucous Fibrosis 20 0.0 0.0
Peritonitis 43 0.0 0.0
Pleural Diseases 10 0.0 0.0
Pneumonia 174 0.0 0.0
Proteinuria 144 0.0 0.0
Radiation Injuries, Experimental 11 0.0 0.0
Renal Insufficiency 90 0.0 0.0
Respiratory Syncytial Virus Infections 5 0.0 0.0
Respiratory Tract Diseases 6 0.0 0.0
Salmonella Infections, Animal 1 0.0 0.0
Sarcoma 62 0.0 0.0
Sepsis 24 0.0 0.0
Stevens-Johnson syndrome 92 0.0 0.0
Trichuriasis 7 0.0 0.0
Tuberous sclerosis 19 0.0 0.0
Tuberous sclerosis 2 2 0.0 0.0
Vomiting 116 0.0 0.0
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
ulcerative colitis 1819 0.0 3.0

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 3.800 3.0e-55
Common variable immunodeficiency 1.526 1.3e-02
cutaneous lupus erythematosus 1.800 1.9e-02
hepatocellular carcinoma -1.600 7.6e-03
interstitial cystitis 2.000 3.4e-03
nasopharyngeal carcinoma 1.100 2.2e-03
pancreatic cancer -2.200 2.0e-02
pancreatic carcinoma -2.200 2.0e-02
tuberculosis and treatment for 3 months -1.600 2.4e-03

Synonym

Accession P01579 B5BU88 Q53ZV4 IFN-gamma
Symbols IFG
IFI

Gene

IFNG

PDB

1FG9   1FYH   1EKU   1HIG   3BES  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

 UniProt Keyword (14)

See all...

 GO Function (2)

 GO Component (6)

 GO Process (81)

See all...

 Compartment GO Term (61)

See all...

 IMPC Phenotype (10)

 OMIM Phenotype (5)

 MGI Phenotype (23)

See all...

 GWAS Trait (3)

 HCA RNA Cell Line (6)

Pathway (89)

See all...

Protein-protein Interaction (2)

IFNGR1   GOPC  

Gene RIF (1808)

AA Sequence 

MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQS      1 - 70
QIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVM     71 - 140
AELSPAAKTGKRKRSQMLFRGRRASQ                                                141 - 166
//

Text Mined References (1644)

PMID Year Title