Property Summary

NCBI Gene PubMed Count 1,643
PubMed Score 5727.43
PubTator Score 15643.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Multiple Sclerosis 540 5.185 2.6
Leishmaniasis 47 4.728 2.4
Hepatitis B 108 4.436 2.2
Hepatitis C 94 4.174 2.1
Atherosclerosis 291 4.024 2.0
Acquired immunodeficiency syndrome 197 0.0 0.0
Adrenoleukodystrophy 29 0.0 0.0
Anemia, Aplastic 7 0.0 0.0
Appendicitis 15 0.0 0.0
Arsenic Poisoning 62 0.0 0.0
Arthritis, Experimental 39 0.0 0.0
Arthritis, Infectious 3 0.0 0.0
Arthritis, Rheumatoid 174 0.0 0.0
Autistic Disorder 364 0.0 0.0
Autoimmune Diseases 67 0.0 0.0
Brain Diseases 24 0.0 0.0
Breast Neoplasms 445 0.0 0.0
Bronchiolitis Obliterans 4 0.0 0.0
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Chills 2 0.0 0.0
Chlamydia Infections 2 0.0 0.0
Colitis 54 0.0 0.0
Colonic Neoplasms 142 0.0 0.0
Crohn Disease 45 0.0 0.0
Dermatitis, Allergic Contact 67 0.0 0.0
Dermatitis, Atopic 37 0.0 0.0
Diabetes Mellitus, Experimental 108 0.0 0.0
Diabetes Mellitus, Type 1 43 0.0 0.0
Disease Models, Animal 155 0.0 0.0
Entamoebiasis 6 0.0 0.0
Eyelid Diseases 2 0.0 0.0
Fever 138 0.0 0.0
Glomerulonephritis 46 0.0 0.0
Graft vs Host Disease 6 0.0 0.0
HIV Infections 102 0.0 0.0
Heart Arrest 3 0.0 0.0
Heart failure 162 0.0 0.0
Hepatitis 67 0.0 0.0
Hepatitis, Autoimmune 17 0.0 0.0
Hypersensitivity 63 0.0 0.0
Hyponatremia 25 0.0 0.0
Hypotension 82 0.0 0.0
Immune Complex Diseases 3 0.0 0.0
Inflammation 120 0.0 0.0
Job Syndrome 3 0.0 0.0
Legionnaires' disease 20 0.0 0.0
Leishmaniasis, Cutaneous 8 0.0 0.0
Leishmaniasis, Mucocutaneous 1 0.0 0.0
Leishmaniasis, Visceral 13 0.0 0.0
Leukemia, Promyelocytic, Acute 36 0.0 0.0
Leukemia-Lymphoma, Adult T-Cell 30 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Lung Neoplasms 232 0.0 0.0
Lymphoproliferative Disorders 6 0.0 0.0
MYCOBACTERIUM TUBERCULOSIS, SUSCEPTIBILITY TO 11 0.0 0.0
Manganese Poisoning 11 0.0 0.0
Melanoma 711 0.0 0.0
Mesothelioma 38 0.0 0.0
Mesothelioma, Malignant 105 0.0 0.0
Nausea 20 0.0 0.0
Necrosis 53 0.0 0.0
Neoplasms, Experimental 40 0.0 0.0
Nerve Degeneration 121 0.0 0.0
Neural Tube Defects 31 0.0 0.0
Oral Submucous Fibrosis 20 0.0 0.0
Peritonitis 43 0.0 0.0
Pleural Diseases 10 0.0 0.0
Pneumonia 174 0.0 0.0
Proteinuria 144 0.0 0.0
Radiation Injuries, Experimental 11 0.0 0.0
Renal Insufficiency 90 0.0 0.0
Respiratory Syncytial Virus Infections 5 0.0 0.0
Respiratory Tract Diseases 6 0.0 0.0
Salmonella Infections, Animal 1 0.0 0.0
Sarcoma 62 0.0 0.0
Sepsis 24 0.0 0.0
Stevens-Johnson syndrome 92 0.0 0.0
Trichuriasis 7 0.0 0.0
Tuberous sclerosis 19 0.0 0.0
Tuberous sclerosis 2 2 0.0 0.0
Vomiting 116 0.0 0.0
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
ulcerative colitis 1819 0.0 3.0

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 3.800 3.0e-55
Common variable immunodeficiency 1.526 1.3e-02
cutaneous lupus erythematosus 1.800 1.9e-02
hepatocellular carcinoma -1.600 7.6e-03
interstitial cystitis 2.000 3.4e-03
nasopharyngeal carcinoma 1.100 2.2e-03
pancreatic cancer -2.200 2.0e-02
pancreatic carcinoma -2.200 2.0e-02
tuberculosis and treatment for 3 months -1.600 2.4e-03

Protein-protein Interaction (2)

Gene RIF (1808)

AA Sequence

MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQS      1 - 70
QIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVM     71 - 140
AELSPAAKTGKRKRSQMLFRGRRASQ                                                141 - 166
//

Text Mined References (1644)

PMID Year Title