Property Summary

NCBI Gene PubMed Count 1,538
PubMed Score 5432.39
PubTator Score 15643.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Leishmaniasis 49
Hepatitis B 103
Hepatitis C 90
Atherosclerosis 275
APLASTIC ANEMIA, SUSCEPTIBILITY TO (finding) 3
Acquired immunodeficiency syndrome 164
Acute Promyelocytic Leukemia 32
Adrenoleukodystrophy 31
Adult T-Cell Lymphoma/Leukemia 30
Aplastic anemia, idiopathic 4
Appendicitis 18
Arthritis, Experimental 39
Arthritis, Infectious 2
Autistic Disorder 320
Autoimmune Diseases 33
Brain Diseases 22
Bronchiolitis Obliterans 5
Cardiac arrest 26
Chills 2
Chlamydia Infections 2
Colitis 46
Colonic Neoplasms 126
Crohn Disease 97
Dermatitis, Allergic Contact 66
Dermatitis, Atopic 45
Diabetes Mellitus, Experimental 106
Diabetes Mellitus, Insulin-Dependent 77
Drug-Induced Liver Injury 118
Entamoebiasis 6
Eyelid Diseases 2
Fever 34
Glomerulonephritis 36
Graft-vs-Host Disease 5
HIV Infections 100
Heart failure 80
Hepatitis 61
Hepatitis, Autoimmune 17
Hypersensitivity 63
Hyponatremia 6
Immune Complex Diseases 3
Infection by Trichuris trichiura 2
Inflammation 109
Job Syndrome 3
Legionnaires' disease 20
Leishmaniasis, Cutaneous 8
Leishmaniasis, Visceral 13
Liver Cirrhosis, Experimental 108
Lung Neoplasms 171
Lymphoproliferative Disorders 3
MYCOBACTERIUM TUBERCULOSIS, SUSCEPTIBILITY TO (finding) 12
Mammary Neoplasms 410
Manganese Poisoning 11
Melanoma 261
Mesothelioma 40
Mucocutaneous leishmaniasis 4
Nausea 9
Necrosis 51
Neoplasms, Experimental 33
Nerve Degeneration 73
Neural Tube Defects 31
Oral Submucous Fibrosis 18
Peritonitis 37
Proteinuria 63
Renal Insufficiency 10
Respiratory Syncytial Virus Infections 5
Respiratory Tract Diseases 6
Salmonella Infections, Animal 1
Sarcoma 49
Sepsis 21
Stevens-Johnson syndrome 91
TUBEROUS SCLEROSIS 1 (disorder) 3
TUBEROUS SCLEROSIS 2 (disorder) 2
Tsc2 Angiomyolipomas, Renal, Modifier Of 1
Tuberous sclerosis 18
Vomiting 9
Disease Target Count P-value
nasopharyngeal carcinoma 1056 0.00224792644352051
tuberculosis and treatment for 3 months 327 0.00240459482589331
interstitial cystitis 2299 0.00336765451756211
hepatocellular carcinoma 550 0.00763299927746864
Common variable immunodeficiency 98 0.0128276204627582
cutaneous lupus erythematosus 1056 0.0189220344077281
pancreatic cancer 2300 0.0196775365479243
pancreatic carcinoma 567 0.0196775365479245
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0
ulcerative colitis 2087 0.0 2.0

Expression

  Differential Expression (9)

Synonym

Accession P01579 B5BU88 Q53ZV4 IFN-gamma
Symbols IFG
IFI

Gene

PDB

1FG9   1FYH   1EKU   1HIG   3BES  

  Ortholog (9)

Gene RIF (1707)

PMID Text
27534050 Maximum risk for Pulmonary tuberculosis is associated with a combination of the AA genotypes of the polymorphic site +874A/Tof the IFNG gene and TT polymorphism G509T of the TGFB gene (AA/TT).
27455566 Interferon-gamma polymorphisms determine human brucellosis predisposition and severity. (Review)
27053161 this study highlights the molecular basis for posttranslational modifications of Gata3 that control the regulation of IFNgamma expression in memory Th2 cells.
27015189 This study suggests IFN-gamma +874T/A polymorphism are related to CML and CLL risk. In addition, our work also points out IFN-gamma +874T/A polymorphism may play dual contrasting role in leukemia risk.
26927386 Data show that during chronic HBV infection, interferon gamma (IFN-gamma) and interleukin 4 (IL-4 )expressed by peripheral blood T cells play dual immunoregulatory roles, which are correlated with the efficacy of entecavir.
26904697 The increased production of TNF-alpha and IFN-gamma in of patients may contribute to the pathogenesis of sicca syndrome associated with HTLV-1 infection.
26893439 IFN-gamma rs2069727 and MICA rs2596542 polymorphisms may be related to the incidence of hepatocellular carcinoma.
26881918 Our results suggested that TNF-alpha may be an ideal biomarker for diagnosing the 3 forms of TB presentation, while the other factors (IL-6, IP-10, MCP-1, and IFN-gamma) can potentially facilitate differential diagnosis for the 3 TB presentation types
26881863 Low interferon-gamma relative-response to cytomegalovirus is associated with low likelihood of intrauterine transmission of the virus.
26783516 Baicalin exhibited anti-influenza virus A (H1N1) activity in vitro and in vivo as a potent inducer of IFN-g in major IFN-g producing cells.
More...

AA Sequence

MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQS      1 - 70
QIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVM     71 - 140
AELSPAAKTGKRKRSQMLFRGRRASQ                                                141 - 166
//

Text Mined References (1539)

PMID Year Title
27534050 2010 [ALLELE POLYMORPHISM OF THE IFNG AND TGFB GENES AS A FACTOR OF MODULATION OF CYTOKINE SECRETION AND SUSCEPTIBILITY TO PULMONARY TUBERCULOSIS].
27455566 2016 [THE PERSPECTIVES OF STUDYING OF POLYMORPHISM OF GENES OF GAMMA-INTERFERON UNDER CHRONIC BRUCELLOSIS].
27053161 2016 Akt1-mediated Gata3 phosphorylation controls the repression of IFN? in memory-type Th2 cells.
27015189 2016 Association of Interferon Gamma +874T/A Polymorphism and Leukemia Risk: A Meta-Analysis.
26927386 2016 [Alterations of IFN-? and IL-4 of peripheral blood T cells in patients with chronic HBV infection].
26904697 2016 Association of Sicca Syndrome with Proviral Load and Proinflammatory Cytokines in HTLV-1 Infection.
26893439 2016 Interaction Between Polymorphisms of IFN-? and MICA Correlated with Hepatocellular Carcinoma.
26881918 2016 Analysis of Plasma Cytokine and Chemokine Profiles in Patients with and without Tuberculosis by Liquid Array-Based Multiplexed Immunoassays.
26881863 2016 Low Interferon Relative-Response to Cytomegalovirus Is Associated with Low Likelihood of Intrauterine Transmission of the Virus.
26783516 2015 Role of Baicalin in Anti-Influenza Virus A as a Potent Inducer of IFN-Gamma.
More...