Property Summary

NCBI Gene PubMed Count 23
PubMed Score 231.08
PubTator Score 220.98

Knowledge Summary

Patent

No data available

Gene RIF (60)

AA Sequence

MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGLPQEEFDGNQ      1 - 70
FQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNNLEACVIQEVGMEETPLMNEDSI     71 - 140
LAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKILRRKD                         141 - 189
//

Text Mined References (25)

PMID Year Title