Property Summary

NCBI Gene PubMed Count 19
PubMed Score 2.01
PubTator Score 7.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

 HCA RNA Cell Line (1)

Protein-protein Interaction (4)

Gene RIF (54)

AA Sequence

MALPFALMMALVVLSCKSSCSLGCNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQ      1 - 70
FQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSI     71 - 140
LAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD                         141 - 189
//

Text Mined References (22)

PMID Year Title