Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.87
PubTator Score 10.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
medulloblastoma, large-cell 6241 1.0e-04

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.300 1.0e-04

 GWAS Trait (2)

Gene RIF (54)

AA Sequence

MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQ      1 - 70
FQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSI     71 - 140
LAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE                         141 - 189
//

Text Mined References (22)

PMID Year Title