Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.90
PubTator Score 10.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Acute hemorrhagic conjunctivitis 5 4.907 2.5

Synonym

Accession P01567 Q14607 Q5VV14 IFN-alpha-7
Symbols IFNA-J
IFN-alphaJ

Gene

Gene RIF (55)

PMID Text
25972534 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
25972534 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
23255800 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
23255800 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
23100517 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
23100517 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
22814248 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
22814248 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
22739040 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
22315404 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
More...

AA Sequence

MARSFSLLMVVLVLSYKSICSLGCDLPQTHSLRNRRALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQ      1 - 70
FQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDFI     71 - 140
LAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSFSFSTNLKKGLRRKD                         141 - 189
//

Text Mined References (14)

PMID Year Title
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11694501 2001 TYK2 and JAK2 are substrates of protein-tyrosine phosphatase 1B.
9425112 1998 Identification of nine interferon-alpha subtypes produced by Sendai virus-induced human peripheral blood leucocytes.
8910771 1996 Identification of interferon-alpha 7, -alpha 14, and -alpha 21 variants in the genome of a large human population.
8668211 1996 Alpha interferon suppresses the cyclin D3 and cdc25A genes, leading to a reversible G0-like arrest.
7510216 1994 Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.
More...