Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.90
PubTator Score 10.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Acute hemorrhagic conjunctivitis 4 4.913 2.5

 HCA RNA Cell Line (1)

Protein-protein Interaction (6)

Gene RIF (49)

AA Sequence

MARSFSLLMVVLVLSYKSICSLGCDLPQTHSLRNRRALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQ      1 - 70
FQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDFI     71 - 140
LAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSFSFSTNLKKGLRRKD                         141 - 189
//

Text Mined References (14)

PMID Year Title