Property Summary

NCBI Gene PubMed Count 19
PubMed Score 16.16
PubTator Score 16.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Protein-protein Interaction (3)

Gene RIF (55)

AA Sequence

MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQ      1 - 70
FQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSI     71 - 140
LAVRKYFQRITLYLIERKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD                         141 - 189
//

Text Mined References (20)

PMID Year Title