Property Summary

NCBI Gene PubMed Count 25
PubMed Score 7663.44
PubTator Score 1.04

Knowledge Summary

Patent

No data available

Expression

Gene RIF (53)

AA Sequence

MASPFALLMVLVVLSCKSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQ      1 - 70
FQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSI     71 - 140
LAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE                         141 - 189
//

Text Mined References (28)

PMID Year Title