Property Summary

NCBI Gene PubMed Count 535
Grant Count 112
R01 Count 81
Funding $9,898,126.59
PubMed Score 612.78
PubTator Score 752.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 0.000

Synonym

Accession P01374 Q8N4C3 Q9UKS8 LT-alpha
Symbols LT
TNFB
TNFSF1
TNLG1E

Gene

LTA

PDB

1TNR   4MXV   4MXW  

 GO Function (1)

Gene RIF (565)

PMID Text
26932696 Polymorphism +252 LT gene did not show any significant association with COPD.
26554163 Studied six SNP loci: (rs2279115 of BCL2 gene, rs804270 of NEIL2 gene, rs909253 of LTA gene, rs2294008 of PSCA gene, rs3765524 and rs10509670 of PLCE1 gene) to evaluate gastric cancer risk using magnetic nanoparticles and universal tagged arrays.
26221924 TNF-alpha (-308G/A), TNF-beta (+252A/G) and IL-10 (-1082G/A, -819C/T and -592C/A) polymorphisms are associated with the susceptibility of oral lichen planus.
26114114 These results support an association between ANKK1 and LTA genetic markers and vulnerability to schizophrenia and show the potential influence of just one copy of the mutant C or G allele in the Egyptian population.
26108796 Studied the association between immuno-modulatory gene polymorphisms (including LTA) and risk for nasal NK/T-cell lymphoma in a Chinese population. Found The LTA +252 GA + AA genotypes were associated with increased risk for NK/T-cell lymphoma.
26076780 TNFB+252G/A was associated with presence of immune thrombocytopenia.
25981594 MTHFR, TGFbeta1, and TNFB polymorphisms are not significantly associated with the risk of osteoporosis in rheumatoid arthritis.
25980610 Biotin-pulldown assay showed that HuR specifically interacts with the 3'-untranslated region (3'-UTR) of the LTalpha mRNA
25931031 LTA polymorphism is associated with genetic susceptibility of systemic lupus in Asians, but not in rheumatoid arthritis.
25915535 LTalpha plays a role in malignant angiogenesis and disease progression in Cutaneous T cell lymphoma and may serve as a therapeutic target in this disease.
More...

AA Sequence

MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGD      1 - 70
PSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSS     71 - 140
QYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL         141 - 205
//

Text Mined References (535)

PMID Year Title
26932696 2015 Association of Tumor Necrosis Factor Alpha and Lymphotoxin Alpha Gene Polymorphisms with the Presence of Chronic Obstructive Pulmonary Disease.
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
26554163 2015 Genetic Variation of BCL2 (rs2279115), NEIL2 (rs804270), LTA (rs909253), PSCA (rs2294008) and PLCE1 (rs3765524, rs10509670) Genes and Their Correlation to Gastric Cancer Risk Based on Universal Tagged Arrays and Fe3O4 Magnetic Nanoparticles.
26221924 TNF-?, TNF-? and IL-10 gene polymorphism and association with oral lichen planus risk in Saudi patients.
26114114 2015 Association between ANKK1 (rs1800497) and LTA (rs909253) Genetic Variants and Risk of Schizophrenia.
26108796 2015 LTA + 252A > G polymorphism is associated with risk of nasal NK/T-cell lymphoma in a Chinese population: a case-control study.
26076780 2015 Single nucleotide polymorphisms of the inflamatory cytokine genes: interleukin-1B, tumor necrosis factors-A and tumor necrosis factor-B in adult patients with immune thrombocytopenia.
25981594 2015 Effect of MTHFR, TGF?1, and TNFB polymorphisms on osteoporosis in rheumatoid arthritis patients.
25980610 2015 Lymphotoxin ?, a novel target of posttranscriptional gene regulation by HuR in HepG2 cells.
25931031 2015 Association of lymphotoxin alpha polymorphism with systemic lupus erythematosus and rheumatoid arthritis: a meta-analysis.
More...