Property Summary

NCBI Gene PubMed Count 549
PubMed Score 629.60
PubTator Score 752.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 3.3e-21

Protein-protein Interaction (1)

Gene RIF (578)

AA Sequence

MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGD      1 - 70
PSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSS     71 - 140
QYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL         141 - 205
//

Text Mined References (549)

PMID Year Title