Property Summary

NCBI Gene PubMed Count 106
PubMed Score 8162.67
PubTator Score 5732.72

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.100 1.4e-03
Multiple Sclerosis 1.100 1.1e-04

Protein-protein Interaction (8)

Gene RIF (71)

AA Sequence

MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVA      1 - 70
DPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN                                            71 - 101
//

Text Mined References (109)

PMID Year Title