Property Summary

NCBI Gene PubMed Count 543
Grant Count 820
R01 Count 431
Funding $73,598,981.16
PubMed Score 4331.73
PubTator Score 2551.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (71)

Disease Z-score Confidence
Beckwith-Wiedemann syndrome 46 6.789 3.4
Proteus syndrome 6 6.043 3.0
Cancer 2,346 6.03 3.0
Klippel-Trenaunay syndrome 15 5.503 2.8
Hypoglycemia 81 5.369 2.7
Silver-Russell syndrome 37 5.323 2.7
Aniridia 26 4.48 2.2
diabetes mellitus 1,663 4.315 2.2
Adenoma 165 4.235 2.1
Potter's syndrome 1 4.171 2.1
Omphalocele 22 4.001 2.0
Acromegaly 40 3.963 2.0
Incontinentia pigmenti achromians 6 3.714 1.9
Lipomatosis 11 3.686 1.8
Scoliosis 40 3.601 1.8
Obesity 616 3.416 1.7
Hyperinsulinism 63 3.407 1.7
Liver disease 219 3.091 1.5
Polycystic Ovary Syndrome 332 3.07 1.5
Simpson-Golabi-Behmel syndrome 17 3.049 1.5
Alzheimer's disease 644
Anemia 252
Atherosclerosis 275
Autistic Disorder 320
Becker muscular dystrophy 187
Bone Diseases, Developmental 25
Cognition Disorders 23
Colonic Neoplasms 126
Colorectal Neoplasms 217
Congenital hemihypertrophy 1
Diabetes Mellitus, Insulin-Dependent 76
Diaphragmatic Hernia 40
Duchenne muscular dystrophy 602
Fetal Growth Retardation 9
Growth Disorders 33
Hepatoblastoma 17
Lewy Body Disease 19
Liver carcinoma 217
Liver neoplasms 109
Memory Disorders 36
Nephroblastoma 45
Nerve Degeneration 73
Parkinson Disease 102
Pick disease 1,893
Placenta Disorders 4
Polyhydramnios 29
Precancerous Conditions 69
Prostate cancer 172 5.0
Rhabdomyosarcoma 29
Russell-Silver syndrome 4
Spontaneous abortion 108
Type 1 diabetes mellitus 101 2.0
adrenocortical carcinoma 1,427
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
cystic fibrosis 1,665
ependymoma 2,514
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2B 74
lung cancer 4,466
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
ovarian cancer 8,484
pilocytic astrocytoma 3,086
pituitary cancer 1,972
psoriasis 6,685
sonic hedgehog group medulloblastoma 1,482

Expression

Synonym

Accession P01344 B3KX48 B7WP08 C9JAF2 E3UN45 P78449 Q14299 Q1WM26 Q9UC68 Q9UC69 IGF-II
Symbols GRDF
IGF-II
PP9974
C11orf43

Gene

PANTHER Protein Class (2)

PDB

3E4Z   1GF2   1IGL   2L29   2V5P   3KR3   5L3L   5L3M   5L3N  

Gene RIF (479)

PMID Text
26840070 the evidence of strong associations between methylation of insulin-like growth factor 2/H19 and macrosomia induced by intrauterine hyperglycemia.
26760116 Low-oxygen tension can modify the IGF-1 or IGF-2 signaling via the IGF-1R and IR in placental mesenchymal stem cells.
26751131 suggest that molecular subtypes of the LIN-28B/let-7a/IGF-II axis associate with heterogeneous progression
26676988 These results demonstrate that IGF2 mRNA expression is more upregulated in fibroadenomas (FAs) and phyllodes tumors (PTs) than in normal tissues
26496499 IGF2 expression in infantile hemangioma is strongly related to the expression of a cancer testes and suspected oncogene BORIS.
26407907 SUZ12 is a key molecule in the regulation of monoallelic expression of IGF2.
26400872 Differential IGF2 and H19 expression characterize pheochromocytomas and adrenocortical carcinomas. Aberrant DNA methylation is found throughout the IGF2/H19 locus. Somatic copy number changes of chr11p15.5 are abundant and correlate with overexpression.
26397886 We conclude that recombinant adenovirus-mediated siRNA targeting CD147 based on the IGF2 LOI system inhibited the growth of the LOI cells in vitro and in vivo, which would provide a novel approach for targeted CRC gene therapy.
26336825 PAPP-A in ascites and tissue-associated PAPP-A serve to increase IGF bioactivity and, thereby, to stimulate IGF-IR-mediated ovarian tumor growth.
26333472 DNA methylation in imprinted genes IGF2 and GNASXL is associated with prenatal maternal stress
More...

AA Sequence

MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEEC      1 - 70
CFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRLRRGLPALLRARRGH     71 - 140
VLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK                                  141 - 180
//

Text Mined References (547)

PMID Year Title
26840070 2016 Alteration in Expression and Methylation of IGF2/H19 in Placenta and Umbilical Cord Blood Are Associated with Macrosomia Exposed to Intrauterine Hyperglycemia.
26760116 2016 Low Oxygen Tension Modulates the Insulin-Like Growth Factor-1 or -2 Signaling via Both Insulin-Like Growth Factor-1 Receptor and Insulin Receptor to Maintain Stem Cell Identity in Placental Mesenchymal Stem Cells.
26751131 2016 LIN-28B/let-7a/IGF-II axis molecular subtypes are associated with epithelial ovarian cancer prognosis.
26676988 2016 Loss of imprinting of IGF2 in fibroadenomas and phyllodes tumors of the breast.
26496499 2015 A Common Polymorphism within the IGF2 Imprinting Control Region Is Associated with Parent of Origin Specific Effects in Infantile Hemangiomas.
26407907 2015 Restoration of IGF2 imprinting by polycomb repressive complex 2 docking factor SUZ12 in colon cancer cells.
26400872 2015 Copy number variations alter methylation and parallel IGF2 overexpression in adrenal tumors.
26397886 2015 Gene therapy for colorectal cancer by adenovirus-mediated siRNA targeting CD147 based on loss of the IGF2 imprinting system.
26336825 2015 PAPP-A proteolytic activity enhances IGF bioactivity in ascites from women with ovarian carcinoma.
26333472 2015 DNA methylation in imprinted genes IGF2 and GNASXL is associated with prenatal maternal stress.
More...