Property Summary

NCBI Gene PubMed Count 543
PubMed Score 4331.73
PubTator Score 2551.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
ependymoma 2514 5.85841645686733E-17
pituitary cancer 1972 2.21990094335339E-13
breast carcinoma 1614 4.74927085697774E-13
Duchenne muscular dystrophy 602 4.81900076476033E-7
malignant mesothelioma 3163 7.72390851822702E-7
juvenile dermatomyositis 1189 6.94415314726849E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 2.23098245775686E-5
cystic fibrosis 1670 2.53132991930826E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.2003617679528E-4
psoriasis 6685 1.28799607465878E-4
sonic hedgehog group medulloblastoma 1482 2.07078290582103E-4
limb girdle muscular dystrophy 2B 74 0.00156891875630832
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00325343321665269
lung cancer 4473 0.00518683727479496
invasive ductal carcinoma 2950 0.00680564133044714
Pick disease 1893 0.00697198505538098
medulloblastoma, large-cell 6234 0.00745855216318452
pilocytic astrocytoma 3086 0.0101812747717748
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0208937244620689
Becker muscular dystrophy 187 0.0293232211069963
ovarian cancer 8492 0.0478383222154094
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 104 0.0 2.0
Disease Target Count Z-score Confidence
Silver-Russell syndrome 37 5.323 2.7
Prostate cancer 172 0.0 5.0

Expression

Synonym

Accession P01344 B3KX48 B7WP08 C9JAF2 E3UN45 P78449 Q14299 Q1WM26 Q9UC68 Q9UC69 IGF-II
Symbols GRDF
IGF-II
PP9974
C11orf43

Gene

PANTHER Protein Class (2)

PDB

3E4Z   1GF2   1IGL   2L29   2V5P   3KR3   5L3L   5L3M   5L3N  

  Ortholog (8)

Gene RIF (479)

PMID Text
26840070 the evidence of strong associations between methylation of insulin-like growth factor 2/H19 and macrosomia induced by intrauterine hyperglycemia.
26760116 Low-oxygen tension can modify the IGF-1 or IGF-2 signaling via the IGF-1R and IR in placental mesenchymal stem cells.
26751131 suggest that molecular subtypes of the LIN-28B/let-7a/IGF-II axis associate with heterogeneous progression
26676988 These results demonstrate that IGF2 mRNA expression is more upregulated in fibroadenomas (FAs) and phyllodes tumors (PTs) than in normal tissues
26496499 IGF2 expression in infantile hemangioma is strongly related to the expression of a cancer testes and suspected oncogene BORIS.
26407907 SUZ12 is a key molecule in the regulation of monoallelic expression of IGF2.
26400872 Differential IGF2 and H19 expression characterize pheochromocytomas and adrenocortical carcinomas. Aberrant DNA methylation is found throughout the IGF2/H19 locus. Somatic copy number changes of chr11p15.5 are abundant and correlate with overexpression.
26397886 We conclude that recombinant adenovirus-mediated siRNA targeting CD147 based on the IGF2 LOI system inhibited the growth of the LOI cells in vitro and in vivo, which would provide a novel approach for targeted CRC gene therapy.
26336825 PAPP-A in ascites and tissue-associated PAPP-A serve to increase IGF bioactivity and, thereby, to stimulate IGF-IR-mediated ovarian tumor growth.
26333472 DNA methylation in imprinted genes IGF2 and GNASXL is associated with prenatal maternal stress
More...

AA Sequence

MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEEC      1 - 70
CFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRLRRGLPALLRARRGH     71 - 140
VLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK                                  141 - 180
//

Text Mined References (547)

PMID Year Title
26840070 2016 Alteration in Expression and Methylation of IGF2/H19 in Placenta and Umbilical Cord Blood Are Associated with Macrosomia Exposed to Intrauterine Hyperglycemia.
26760116 2016 Low Oxygen Tension Modulates the Insulin-Like Growth Factor-1 or -2 Signaling via Both Insulin-Like Growth Factor-1 Receptor and Insulin Receptor to Maintain Stem Cell Identity in Placental Mesenchymal Stem Cells.
26751131 2016 LIN-28B/let-7a/IGF-II axis molecular subtypes are associated with epithelial ovarian cancer prognosis.
26676988 2016 Loss of imprinting of IGF2 in fibroadenomas and phyllodes tumors of the breast.
26496499 2015 A Common Polymorphism within the IGF2 Imprinting Control Region Is Associated with Parent of Origin Specific Effects in Infantile Hemangiomas.
26407907 2015 Restoration of IGF2 imprinting by polycomb repressive complex 2 docking factor SUZ12 in colon cancer cells.
26400872 2015 Copy number variations alter methylation and parallel IGF2 overexpression in adrenal tumors.
26397886 2015 Gene therapy for colorectal cancer by adenovirus-mediated siRNA targeting CD147 based on loss of the IGF2 imprinting system.
26336825 2015 PAPP-A proteolytic activity enhances IGF bioactivity in ascites from women with ovarian carcinoma.
26333472 2015 DNA methylation in imprinted genes IGF2 and GNASXL is associated with prenatal maternal stress.
More...