Property Summary

NCBI Gene PubMed Count 759
PubMed Score 141255.37
PubTator Score 51392.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 104 0.0 5.0
Disease Target Count Z-score Confidence
diabetes mellitus 1663 9.701 4.0
Disease Target Count Z-score Confidence
Hypertension 293 6.892 3.4
Lipid metabolism disorder 102 6.566 3.3
Coronary artery disease 240 6.243 3.1
Kidney disease 397 6.127 3.1
Hyperandrogenism 32 6.055 3.0
Atherosclerosis 275 5.923 3.0
Acanthosis nigricans 14 5.907 3.0
Fatty liver disease 86 5.877 2.9
Adenoma 165 5.704 2.9
Hyperinsulinemic hypoglycemia 17 5.578 2.8
Neuropathy 210 5.506 2.8
Diabetic Retinopathy 53 5.505 2.8
Cancer 2346 5.476 2.7
Lipodystrophy 32 5.384 2.7
Heart disease 279 5.291 2.6
Anovulation 20 5.232 2.6
Autonomic neuropathy 21 5.176 2.6
Liver disease 219 5.114 2.6
Cerebrovascular disease 231 5.045 2.5
Acromegaly 40 4.948 2.5
Lactic acidosis 43 4.938 2.5
Hypersensitivity reaction type II disease 235 4.842 2.4
Donohue Syndrome 6 4.689 2.3
Hypothyroidism 89 4.688 2.3
Hypopituitarism 36 4.622 2.3
Eating disorder 24 4.428 2.2
Hyperthyroidism 50 4.333 2.2
Infertility 163 4.327 2.2
Brain disease 84 4.31 2.2
Allergic hypersensitivity disease 123 4.306 2.2
Peripheral vascular disease 90 4.184 2.1
Cushing's syndrome 47 4.177 2.1
Hypogonadism 70 4.154 2.1
Duodenal ulcer 20 4.148 2.1
Amenorrhea 60 4.094 2.0
Hyperuricemia 35 4.041 2.0
Obstructive sleep apnea 28 3.971 2.0
Schizophrenia 503 3.854 1.9
cystic fibrosis 1670 3.836 1.9
Dementia 129 3.769 1.9
Diarrhea 155 3.76 1.9
Dumping syndrome 9 3.756 1.9
Osteoporosis 259 3.633 1.8
Blindness 84 3.585 1.8
Thyrotoxicosis 38 3.583 1.8
Hyperprolactinemia 22 3.557 1.8
Prader-Willi syndrome 45 3.544 1.8
Lung disease 136 3.517 1.8
Gastroparesis 20 3.494 1.7
Anemia 252 3.354 1.7
Impotence 45 3.315 1.7
Addison's disease 29 3.265 1.6
protein-energy malnutrition 8 3.22 1.6
Arthritis 248 3.216 1.6
Glycogen storage disease 37 3.214 1.6
Pituitary adenoma 35 3.212 1.6
Hepatitis C 90 3.206 1.6
Cataract 104 3.196 1.6
Wolfram syndrome 11 3.15 1.6
Steatorrhea 20 3.144 1.6
Macular retinal edema 11 3.129 1.6
Pancreatic agenesis 14 3.123 1.6
Exocrine pancreatic insufficiency 21 3.107 1.6
Hyperparathyroidism 43 3.107 1.6
ADULT syndrome 9 3.047 1.5

Expression

See source...

Synonym

Accession P01308 Q5EEX2
Symbols IDDM
ILPR
IRDN
IDDM1
IDDM2
MODY10

Gene

INS

PANTHER Protein Class (2)

PDB

2G54   2G56   2WBY   2WC0   4Q5Z   5CJO   1A7F   1AI0   1AIY   1B9E   1BEN   1EFE   1EV3   1EV6   1EVR   1FU2   1FUB   1G7A   1G7B   1GUJ   1HIQ   1HIS   1HIT   1HLS   1HTV   1HUI   1IOG   1IOH   1J73   1JCA   1JCO   1JK8   1K3M   1KMF   1LKQ   1LPH   1MHI   1MHJ   1MSO   1OS3   1OS4   1Q4V   1QIY   1QIZ   1QJ0   1RWE   1SF1   1SJT   1SJU   1T0C   1T1K   1T1P   1T1Q   1TRZ   1TYL   1TYM   1UZ9   1VKT   1W8P   1XDA   1XGL   1XW7   1ZEG   1ZEH   1ZNJ   2AIY   2C8Q   2C8R   2CEU   2H67   2HH4   2HHO   2HIU   2JMN   2JUM   2JUU   2JUV   2JV1   2JZQ   2K91   2K9R   2KJJ   2KJU   2KQP   2KQQ   2KXK   2L1Y   2L1Z   2LGB   2LWZ   2M1D   2M1E   2M2M   2M2N   2M2O   2M2P   2MLI   2MPG   2MPI   2MVC   2MVD   2N2V   2N2W   2N2X   2OLY   2OLZ   2OM0   2OM1   2OMG   2OMH   2OMI   2OMQ   2QIU   2R34   2R35   2R36   2RN5   2VJZ   2VK0   2W44   2WRU   2WRV   2WRW   2WRX   2WS0   2WS1   2WS4   2WS6   2WS7   3AIY   3BXQ   3E7Y   3E7Z   3EXX   3FQ9   3HYD   3I3Z   3I40   3ILG   3INC   3IR0   3JSD   3KQ6   3P2X   3P33   3Q6E   3ROV   3TT8   3U4N   3UTQ   3UTS   3UTT   3V19   3V1G   3W11   3W12   3W13   3W7Y   3W7Z   3W80   3ZI3   3ZQR   3ZS2   3ZU1   4AIY   4AJX   4AJZ   4AK0   4AKJ   4CXL   4CXN   4CY7   4EFX   4EWW   4EWX   4EWZ   4EX0   4EX1   4EXX   4EY1   4EY9   4EYD   4EYN   4EYP   4F0N   4F0O   4F1A   4F1B   4F1C   4F1D   4F1F   4F1G   4F4T   4F4V   4F51   4F8F   4FG3   4FKA   4GBC   4GBI   4GBK   4GBL   4GBN   4IUZ   4IYD   4IYF   4NIB   4OGA   4P65   4RXW   4UNE   4UNG   4UNH   4WDI   4XC4   4Y19   4Y1A   4Z76   4Z77   4Z78   5AIY   5BOQ   5BPO   5BQQ   5BTS   5C0D   5CNY   5CO2   5CO6   5CO9   5EN9   5ENA   5HYJ  

  Ortholog (12)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (679)

PMID Text
27129279 The conserved tyrosine B26 contribute to the function and stability of human insulin.
26968895 Data suggest that resveratrol acts on differentiating preadipocytes by inhibiting insulin signaling, mitochondrial biogenesis, and lipogenesis.
26930065 Studies indicate key feedback loops involved in the cross-talk among the insulin-proto-oncogene protein c-akt (AKT) and MAPK/ERK signaling pathways.
26902691 Metformin resulted in a significant reduction of IGF-1, IGF-1: IGFBP-3 molar ratio, insulin, FBG and HOMA-IR. On the other hand, metformin caused a significant increase of IGFBP-3.
26849622 Insulin increases the expression of TRPC6 channels in podocytes by activation of the calcineurin-dependent pathway.
26836020 The regulated sorting of ICA512 to secretory granules in INS-1 cells was impaired by deletion of RESP18HD. ICA512-RESP18HD binds with high-affinity to insulin and proinsulin.
26824044 Detection of proinsulin antibodies in blood precedes detection of classical islet antibodies in children at risk of developing diabetes mellitus type 1.
26592151 Data (including data from studies in mutant mice) suggest up-regulation of CST3 (cystatin C), as observed in plasma of mice with type 2 diabetes, down-regulates INS signaling and promotes endoplasmic reticulum stress in hepatocytes but not myotubes.
26584065 insulin and leptin receptors have positive effects on signaling, contributing to high signaling levels in Gestational diabetes placenta.
26505114 Data (including data from studies in transgenic mice) suggest intraislet pancreatic duct cells are capable of giving rise to insulin-secreting beta-cells; pancreatic ductal cells from children (but not from adults) exhibit such transdifferentiation.
More...

AA Sequence

MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG      1 - 70
GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN                                   71 - 110
//

Text Mined References (759)

PMID Year Title
27129279 2016 Contribution of TyrB26 to the Function and Stability of Insulin: STRUCTURE-ACTIVITY RELATIONSHIPS AT A CONSERVED HORMONE-RECEPTOR INTERFACE.
26968895 2016 Resveratrol inhibits lipogenesis of 3T3-L1 and SGBS cells by inhibition of insulin signaling and mitochondrial mass increase.
26930065 2016 Dynamic Modeling and Analysis of the Cross-Talk between Insulin/AKT and MAPK/ERK Signaling Pathways.
26902691 2016 Metformin may protect nondiabetic breast cancer women from metastasis.
26849622 2016 Insulin Increases Expression of TRPC6 Channels in Podocytes by a Calcineurin-Dependent Pathway.
26836020 2016 Biochemical, biophysical, and functional properties of ICA512/IA-2 RESP18 homology domain.
26824044 2016 Recognition of ZnT8, Proinsulin, and Homologous MAP Peptides in Sardinian Children at Risk of T1D Precedes Detection of Classical Islet Antibodies.
26592151 2015 Cystatin C attenuates insulin signaling transduction by promoting endoplasmic reticulum stress in hepatocytes.
26584065 2016 Insulin and Leptin Signaling in Placenta from Gestational Diabetic Subjects.
26505114 2016 Intraislet Pancreatic Ducts Can Give Rise to Insulin-Positive Cells.
More...