Property Summary

NCBI Gene PubMed Count 817
PubMed Score 146933.74
PubTator Score 51392.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
diabetes mellitus 1728 9.762 4.0
Hypoglycemia 152 8.828 4.0
Hyperglycemia 137 8.538 4.0
Obesity 678 8.349 4.0
Hyperinsulinism 133 8.223 4.0
Polycystic ovary syndrome 360 7.192 3.6
Hypertension 396 6.938 3.5
Pancreatitis 123 5.341 2.7
Hypokalemia 52 4.251 2.1
Acute kidney injury 70 0.0 0.0
Albuminuria 21 0.0 0.0
Alzheimer Disease 83 0.0 0.0
Bipolar Disorder 666 0.0 0.0
Cardiomyopathy, Hypertrophic 24 0.0 0.0
DIABETES MELLITUS, INSULIN-DEPENDENT, 2 1 0.0 0.0
DIABETES MELLITUS, PERMANENT NEONATAL 5 0.0 0.0
Diabetes Mellitus, Type 1 43 0.0 0.0
Diabetes Mellitus, Type 2 142 0.0 0.0
Diabetic Cardiomyopathies 10 0.0 0.0
Diabetic Nephropathies 37 0.0 0.0
Edema 81 0.0 0.0
Fatty Liver 70 0.0 0.0
Glucose Intolerance 19 0.0 0.0
Heart Arrest 3 0.0 0.0
Heart failure 162 0.0 0.0
Hepatitis 67 0.0 0.0
Hyperkalemia 17 0.0 0.0
Hyperproinsulinemia 1 0.0 0.0
Hypertriglyceridemia 17 0.0 0.0
Hypotension 82 0.0 0.0
Insulin Resistance 72 0.0 0.0
Kidney Diseases, Cystic 6 0.0 0.0
Lewy Body Disease 21 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Liver Failure, Acute 29 0.0 0.0
MPTP Poisoning 1 0.0 0.0
Maturity-Onset Diabetes of the Young, Type 10 2 0.0 0.0
Memory Disorders 40 0.0 0.0
Metabolic Diseases 10 0.0 0.0
Metabolic Syndrome 20 0.0 0.0
Micronuclei, Chromosome-Defective 25 0.0 0.0
Muscular Diseases 27 0.0 0.0
Neural Tube Defects 31 0.0 0.0
Neurocognitive Disorders 1 0.0 0.0
Panic disorder 61 0.0 0.0
Paralysis 9 0.0 0.0
Paresthesia 32 0.0 0.0
Parkinson Disease 64 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Renal Insufficiency 90 0.0 0.0
Rhabdomyolysis 15 0.0 0.0
Seizures 596 0.0 0.0
Tachycardia 43 0.0 0.0
Telomeric 22q13 Monosomy Syndrome 2 0.0 0.0
Urinary Bladder Diseases 5 0.0 0.0
Ventricular Dysfunction, Left 22 0.0 0.0
Ventricular Fibrillation 17 0.0 0.0
Ventricular Outflow Obstruction 1 0.0 0.0
Weight Loss 24 0.0 0.0
diabetic ketoacidosis 3 0.0 0.0
Disease Target Count
Neuropathy 261
Alzheimer's disease 658
Metabolic syndrome X 52
Myopathy 185
Abnormality of the immune system 18
Anteverted nostril 191
Arthrogryposis 54
Axial hypotonia 46
Beta-cell dysfunction 5
Bilateral ptosis 9
Blepharoptosis 231
Cardiac arrest 36
Cognitive delay 608
Congenital Heart Defects 58
Congenital clinodactyly 57
Congenital ear anomaly NOS (disorder) 29
Congenital heart disease 93
Contracture of lower limb 6
Curvature of digit 57
Cystic Kidney Diseases 6
Dehydration 40
Diabetes Mellitus, Insulin-Dependent 48
Diabetes Mellitus, Non-Insulin-Dependent 145
Diabetic Nephropathy 34
Downturned corners of mouth 48
Epilepsies, Myoclonic 32
Epilepsy 792
Failure to gain weight 365
Fetal Growth Retardation 189
Generalized myoclonic seizures 30
Global developmental delay 608
Glycosuria 29
High urine albumin levels 5
Hypertensive disease 292
Hypertrophic Cardiomyopathy 117
Hypovolemia 8
Hypsarrhythmia 25
Impaired glucose tolerance 28
Infant, Small for Gestational Age 176
Intrauterine retardation 176
Ketoacidosis 11
Ketonuria 8
Limb contractures 6
Long philtrum 137
Low Birth Weights 69
Maturity onset diabetes mellitus in young 11
Mental and motor retardation 608
Microalbuminuria 5
Motor delay 147
Muscle Weakness 170
Myoclonic Epilepsies, Progressive 44
Neonatal insulin-dependent diabetes mellitus 6
No development of motor milestones 147
Paralysed 42
Pediatric failure to thrive 365
Peripheral Neuropathy 134
Prominent metopic ridge 15
Radially deviated fingers 38
Reduced pancreatic beta cells 6
Retinal Diseases 55
Short nose 132
Small for gestational age (disorder) 69
Small nose 132
Tonic - clonic seizures 44
Unipolar Depression 250
Weight decreased 103
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 109 0.0 5.0
Disease Target Count Z-score Confidence
Lipid metabolism disorder 114 6.619 3.3
Coronary artery disease 268 6.268 3.1
Kidney disease 430 6.207 3.1
Hyperandrogenism 34 6.109 3.1
Fatty liver disease 103 5.965 3.0
Acanthosis Nigricans 27 5.954 3.0
Atherosclerosis 291 5.953 3.0
Adenoma 167 5.739 2.9
Hyperinsulinemic hypoglycemia 17 5.635 2.8
Cancer 2499 5.536 2.8
Diabetic retinopathy 56 5.515 2.8
Lipodystrophy 40 5.419 2.7
Heart disease 306 5.341 2.7
Anovulation 21 5.289 2.6
Autonomic neuropathy 22 5.184 2.6
Liver disease 237 5.16 2.6
Cerebrovascular disease 238 5.07 2.5
Lactic acidosis 51 5.052 2.5
Acromegaly 51 4.982 2.5
Hypersensitivity reaction type II disease 253 4.923 2.5
Donohue syndrome 6 4.739 2.4
Hypothyroidism 122 4.738 2.4
Hypopituitarism 40 4.701 2.4
Eating disorder 26 4.494 2.2
Hyperthyroidism 53 4.383 2.2
Infertility 188 4.383 2.2
Allergic hypersensitivity disease 126 4.339 2.2
Brain disease 96 4.267 2.1
Cushing's syndrome 48 4.208 2.1
Duodenal ulcer 20 4.204 2.1
Peripheral vascular disease 87 4.198 2.1
Hypogonadism 173 4.19 2.1
Amenorrhea 58 4.114 2.1
Hyperuricemia 47 4.097 2.0
Obstructive sleep apnea 26 4.063 2.0
cystic fibrosis 1696 3.942 2.0
Schizophrenia 1160 3.915 2.0
Dementia 175 3.9 1.9
Dumping syndrome 8 3.881 1.9
Diarrhea 253 3.813 1.9
Osteoporosis 363 3.713 1.9
Blindness 88 3.628 1.8
Thyrotoxicosis 38 3.618 1.8
Prader-Willi syndrome 48 3.588 1.8
Hyperprolactinemia 27 3.575 1.8
Lung disease 142 3.572 1.8
Gastroparesis 22 3.528 1.8
Anemia 365 3.407 1.7
Impotence 46 3.369 1.7
Addison's disease 31 3.333 1.7
Arthritis 290 3.284 1.6
Hepatitis C 94 3.278 1.6
Glycogen storage disease 39 3.255 1.6
protein-energy malnutrition 8 3.241 1.6
Pituitary adenoma 38 3.223 1.6
Cataract 297 3.204 1.6
Steatorrhea 34 3.195 1.6
Wolfram syndrome 12 3.186 1.6
Macular retinal edema 13 3.16 1.6
Hyperparathyroidism 48 3.145 1.6
ADULT syndrome 9 3.11 1.6
Exocrine pancreatic insufficiency 32 3.106 1.6
Polyneuropathy 64 3.032 1.5
Mood disorder 14 3.013 1.5
Craniopharyngioma 16 3.005 1.5

Expression

See source...

Synonym

Accession P01308 Q5EEX2
Symbols IDDM
ILPR
IRDN
IDDM1
IDDM2
MODY10

Gene

INS

PDB

2G54   2G56   2WBY   2WC0   4Q5Z   5CJO   1A7F   1AI0   1AIY   1B9E   1BEN   1EFE   1EV3   1EV6   1EVR   1FU2   1FUB   1G7A   1G7B   1GUJ   1HIQ   1HIS   1HIT   1HLS   1HTV   1HUI   1IOG   1IOH   1J73   1JCA   1JCO   1JK8   1K3M   1KMF   1LKQ   1LPH   1MHI   1MHJ   1MSO   1OS3   1OS4   1Q4V   1QIY   1QIZ   1QJ0   1RWE   1SF1   1SJT   1SJU   1T0C   1T1K   1T1P   1T1Q   1TRZ   1TYL   1TYM   1UZ9   1VKT   1W8P   1XDA   1XGL   1XW7   1ZEG   1ZEH   1ZNJ   2AIY   2C8Q   2C8R   2CEU   2H67   2HH4   2HHO   2HIU   2JMN   2JUM   2JUU   2JUV   2JV1   2JZQ   2K91   2K9R   2KJJ   2KJU   2KQP   2KQQ   2KXK   2L1Y   2L1Z   2LGB   2LWZ   2M1D   2M1E   2M2M   2M2N   2M2O   2M2P   2MLI   2MPG   2MPI   2MVC   2MVD   2N2V   2N2W   2N2X   2OLY   2OLZ   2OM0   2OM1   2OMG   2OMH   2OMI   2OMQ   2QIU   2R34   2R35   2R36   2RN5   2VJZ   2VK0   2W44   2WRU   2WRV   2WRW   2WRX   2WS0   2WS1   2WS4   2WS6   2WS7   3AIY   3BXQ   3E7Y   3E7Z   3EXX   3FQ9   3HYD   3I3Z   3I40   3ILG   3INC   3IR0   3JSD   3KQ6   3P2X   3P33   3Q6E   3ROV   3TT8   3U4N   3UTQ   3UTS   3UTT   3V19   3V1G   3W11   3W12   3W13   3W7Y   3W7Z   3W80   3ZI3   3ZQR   3ZS2   3ZU1   4AIY   4AJX   4AJZ   4AK0   4AKJ   4CXL   4CXN   4CY7   4EFX   4EWW   4EWX   4EWZ   4EX0   4EX1   4EXX   4EY1   4EY9   4EYD   4EYN   4EYP   4F0N   4F0O   4F1A   4F1B   4F1C   4F1D   4F1F   4F1G   4F4T   4F4V   4F51   4F8F   4FG3   4FKA   4GBC   4GBI   4GBK   4GBL   4GBN   4IUZ   4IYD   4IYF   4NIB   4OGA   4P65   4RXW   4UNE   4UNG   4UNH   4WDI   4XC4   4Y19   4Y1A   4Z76   4Z77   4Z78   5AIY   5BOQ   5BPO   5BQQ   5BTS   5C0D   5CNY   5CO2   5CO6   5CO9   5E7W   5EMS   5EN9   5ENA   5HPR   5HPU   5HQI   5HRQ   5HYJ   5MAM   5MHD   5MT3   5MT9   5UDP   5VIZ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (735)

AA Sequence

MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG      1 - 70
GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN                                   71 - 110
//

Text Mined References (817)

PMID Year Title