Property Summary

NCBI Gene PubMed Count 277
Grant Count 1,526
R01 Count 938
Funding $156,965,130.99
PubMed Score 7285.29
PubTator Score 1859.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (57)

Disease Z-score Confidence
Obesity 616 6.42 3.2
Epilepsy 346 5.052 2.5
Anorexia nervosa 59 4.69 2.3
Hypertension 287 4.576 2.3
diabetes mellitus 1,663 4.567 2.3
Alcohol dependence 107 4.543 2.3
post-traumatic stress disorder 45 4.393 2.2
Hyperinsulinism 63 4.087 2.0
Bulimia nervosa 15 3.977 2.0
Hyperglycemia 120 3.907 2.0
Huntington's disease 72 3.876 1.9
Kidney failure 39 3.828 1.9
Schizophrenia 501 3.826 1.9
Metabolic syndrome X 155 3.706 1.9
Phaeochromocytoma 20 3.622 1.8
Hypoglycemia 81 3.405 1.7
Cancer 2,346 3.403 1.7
Alzheimer's disease 644 3.369 1.7
Gastrointestinal system disease 50 3.306 1.7
Autonomic neuropathy 21 3.27 1.6
Heart disease 279 3.091 1.5
Major Depressive Disorder 106 3.036 1.5
Cerebrovascular disease 231 3.021 1.5
Migraine 79 3.004 1.5
Alcoholic Intoxication, Chronic 41
Anorexia 15
Anxiety Disorders 37
Asthma 349
Bronchitis, Chronic 9
Cardiovascular Diseases 50
Cerebral Infarction 9
Cocaine-Related Disorders 88
Depressive disorder 48
Epilepsy, Temporal Lobe 23
Hyperactive behavior 31
Memory Disorders 36
Muscle Rigidity 5
Nasal obstruction present finding 1
Osteoporosis 257 1.0
Periodontal disease 37 2.0
Peripheral Neuropathy 303
Pick disease 1,893
Rhinitis 46
Seizures 95
Substance Withdrawal Syndrome 52
Substance-Related Disorders 114
Weight decreased 18
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
glioblastoma 5,572
medulloblastoma 1,524
medulloblastoma, large-cell 6,234
oligodendroglioma 2,849
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
psoriasis 6,685

Expression

  Differential Expression (12)

Disease log2 FC p
Alzheimer's disease -1.800 0.027
astrocytoma -3.100 0.001
oligodendroglioma -2.000 0.000
glioblastoma -3.000 0.001
posterior fossa group A ependymoma -2.500 0.000
medulloblastoma -3.200 0.000
atypical teratoid / rhabdoid tumor -1.600 0.024
medulloblastoma, large-cell -2.800 0.007
pediatric high grade glioma -2.200 0.004
pilocytic astrocytoma -3.100 0.000
Pick disease -1.800 0.001
psoriasis -1.300 0.003

Synonym

Accession P01303
Symbols PYY4

Gene

NPY

PDB

1QFA   1RON  

Gene RIF (267)

PMID Text
26683132 NPY plays important roles in the pathogenesis and pathophysiology of pituitary adenomas, as shown in this clinical study.
26621486 NPY is efficiently cleaved by FAP indicating a potential function for FAP in neuropeptide regulation within liver and cancer biology.
26291814 NPY levels were higher in both obese and non-obese PCOS patients compared to healthy controls.
26240981 This study suggests that NPY rs16147 T and rs16139 C minor alleles are associated with increased risk, whereas the minor allele T of the rs5574 is associated with a reduced risk of obesity.
26220979 Authors observed that NPY levels were decreased in two Machado-Joseph disease patients' cerebella.
26156739 Data suggest that an SNP in NPY (rs16147) is associated with change in abdominal adiposity in subjects with central obesity in response to dietary interventions (low/high fat); T allele carriers on high-fat diet regained abdominal fat.
26111352 Suggest IL-4 as marker of allergic airway inflammation in asthma, and roles for adiponectin and neuropeptide Y in neurohormonal signaling.
26021463 The mean neuropeptide-Y level was 62.29 +/- 13.89 pg/mL in the breath-holding spells group and 58.24 +/- 12.30 pg/mL in the control group.
26002416 Immunohistochemical distribution of this peptide in the epidermal skin (from abdomen, breast and face) of healthy women was analysed.
25924821 The C-terminal alpha-helix of Neuropeptide Y, which is formed in a membrane environment in the absence of the receptor, is unwound starting at T(32) to provide optimal contacts in a binding pocket within the transmembrane bundle of the NPY-Y2 receptor.
More...

AA Sequence

MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSP      1 - 70
ETLISDLLMRESTENVPRTRLEDPAMW                                                71 - 97
//

Text Mined References (279)

PMID Year Title
26683132 2015 Expression of Neuropeptide Y and Its Relationship with Molecular and Morphological Changes in Human Pituitary Adenomas.
26621486 2016 Neuropeptide Y is a physiological substrate of fibroblast activation protein: Enzyme kinetics in blood plasma and expression of Y2R and Y5R in human liver cirrhosis and hepatocellular carcinoma.
26291814 2015 Examination of angiopoietin-like protein 4, neuropeptide Y, omentin-1 levels of obese and non-obese patients with polycystic ovary syndrome.
26240981 2015 Comprehensive evaluation of the neuropeptide-Y gene variants in the risk of obesity: a case-control study and meta-analysis.
26220979 2015 Neuropeptide Y mitigates neuropathology and motor deficits in mouse models of Machado-Joseph disease.
26156739 2015 Neuropeptide Y genotype, central obesity, and abdominal fat distribution: the POUNDS LOST trial.
26111352 2015 Obesity, asthma prevalence and IL-4: Roles of inflammatory cytokines, adiponectin and neuropeptide Y.
26021463 2015 Assessment of both serum S-100B protein and neuropeptide-Y levels in childhood breath-holding spells.
26002416 2015 Immunohistochemical distribution of neuropeptide Y, peptide YY, pancreatic polypeptide-like immunoreactivity and their receptors in the epidermal skin of healthy women.
25924821 2015 Unwinding of the C-Terminal Residues of Neuropeptide Y is critical for Y? Receptor Binding and Activation.
More...