Property Summary

NCBI Gene PubMed Count 38
PubMed Score 2400.27
PubTator Score 611.94

Knowledge Summary

Patent

No data available

Expression

 IMPC Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (24)

AA Sequence

MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHK      1 - 70
EDTLAFSEWGSPHAAVPRELSPLDL                                                  71 - 95
//

Text Mined References (40)

PMID Year Title