Property Summary

NCBI Gene PubMed Count 36
Grant Count 83
R01 Count 45
Funding $6,519,077.53
PubMed Score 2260.37
PubTator Score 611.94

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P01298
Symbols PP
PNP

Gene

PPY

PDB

1TZ4   1TZ5  

Gene RIF (22)

PMID Text
26002416 Immunohistochemical distribution of this peptide in the epidermal skin (from abdomen, breast and face) of healthy women was analysed.
25990478 The most important parameter in diagnosis of HG [Hyperemesis gravidarum ]was plasma PP level
25445712 These data demonstrate glucose-regulated secretion of PP and its effects on glucagon release through PPYR1 receptors expressed by alpha-cells.
24375409 Pancreatic polypeptide is recognized by two hydrophobic domains of the human Y4 receptor binding pocket.
23956349 The diagnostic accuracy of the tumor markers CgA, PP, and glucagon for pancreatic neuroendocrine tumors in multiple endocrine neoplasia type 1 is low.
23371976 Pancreatic polypeptide (and peptide tyrosine-tyrosine) increases in obese woman on caloric restriction following high protein liquid meals compared to high carbohydrate liquid meals.
22979996 These findings underscore the important role of the NPY-Y receptor system at several levels of the gut-brain axis in which NPY, peptide yy and pancreatic polypeptide operate both as neural and endocrine messengers--{REVIEW}
22673566 Data suggest that beta-cell function improves in overweight subjects with type 2 diabetes who lose weight by dieting; this change is associated with a decrease in PPY secretion (i.e., plasma PPY is decreased).
22399387 Self-association of PPY with phospholipid micelles addressed the delivery issues of the peptide for diabetes treatment.
21813805 Women with bulimia nervosa have significantly lower fasting and postprandial serum concentrations of pancreatic polypeptide (and GLP-1) than control subjects.
More...

AA Sequence

MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHK      1 - 70
EDTLAFSEWGSPHAAVPRELSPLDL                                                  71 - 95
//

Text Mined References (38)

PMID Year Title
26002416 2015 Immunohistochemical distribution of neuropeptide Y, peptide YY, pancreatic polypeptide-like immunoreactivity and their receptors in the epidermal skin of healthy women.
25990478 2015 Gut satiety hormones and hyperemesis gravidarum.
25445712 2015 Pancreatic polypeptide regulates glucagon release through PPYR1 receptors expressed in mouse and human alpha-cells.
24375409 2014 Pancreatic polypeptide is recognized by two hydrophobic domains of the human Y4 receptor binding pocket.
23956349 2013 Low accuracy of tumor markers for diagnosing pancreatic neuroendocrine tumors in multiple endocrine neoplasia type 1 patients.
23371976 2013 Liquid meal composition, postprandial satiety hormones, and perceived appetite and satiety in obese women during acute caloric restriction.
22979996 2012 Neuropeptide Y, peptide YY and pancreatic polypeptide in the gut-brain axis.
22673566 Improvement in ?-cell function after diet-induced weight loss is associated with decrease in pancreatic polypeptide in subjects with type 2 diabetes.
22399387 2012 Human pancreatic polypeptide in a phospholipid-based micellar formulation.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
More...