Property Summary

NCBI Gene PubMed Count 65
Grant Count 261
R01 Count 138
Funding $24,269,404.37
PubMed Score 1883.40
PubTator Score 2158.53

Knowledge Summary

Patent

No data available

Synonym

Accession P01286 Q4KN10 Q5JYR1
Symbols GRF
INN
GHRF

Gene

PDB

5BQM  

Gene RIF (43)

PMID Text
26671997 GHRH excess and blockade in X-LAG syndrome
23689947 After 20 weeks of GHRH administration, gamma-aminobutyric acid levels are increased in all brain regions, N-acetylaspartylglutamate levels are increased in the dorsolateral frontal cortex, and myoinositol levels are decreased in the posterior cingulate.
23542451 case Report: multiple endocrine neoplasia type 1 family characterized by primary hyperparathyroidism, in association with acromegaly because of ectopic GHRH secretion by a pancreatic neuroendocrine tumor in a young man.
22423511 The pathomechanisms involved in the genetic defects at both ends of the GHRH-IGF-1 axis.
21715545 GHRH mutations were not identified in a selected cohort of patients with isolated GH deficiency, suggesting that, if they exist, they may be an extremely rare cause of isolated GH deficiency.
21478211 The present paper will give an overview of the main cardiovascular actions of the ghrelin gene-derived peptides and of GHRH.
21274339 Studies indicate that appropriate consideration should be given to genetic defects in GH-1, IGF-I and GHRH causing growth hormone (GH) deficiency.
21196925 Data show that GHRH can stimulate the secretion of IL-17 from human peripheral blood mononuclear cells.
20869425 A single nucleotide polymorphism (SNP) in GnRH shows relationship to central precocious puberty in Chinese Han girls.
20843274 Pretreatment with GHRH for 12 days could restore pituitary responsiveness to GHRH either in healthy aged men and growth hormone-deficient adult patients.
More...

AA Sequence

MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERG      1 - 70
ARARLGRQVDSMWAEQKQMELESILVALLQKHSRNSQG                                     71 - 108
//

Text Mined References (66)

PMID Year Title
26671997 2016 GHRH excess and blockade in X-LAG syndrome.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23689947 2013 Growth hormone-releasing hormone effects on brain ?-aminobutyric acid levels in mild cognitive impairment and healthy aging.
23542451 2013 Growth hormone-releasing hormone-producing pancreatic neuroendocrine tumor in a multiple endocrine neoplasia type 1 family with an uncommon phenotype.
22423511 2011 From GHRH to IGF-1 and downstream: clinical phenotypes and biological mechanisms.
21715545 2011 Absence of GH-releasing hormone (GHRH) mutations in selected patients with isolated GH deficiency.
21478211 2011 Cardiovascular actions of the ghrelin gene-derived peptides and growth hormone-releasing hormone.
21274339 2010 Genetics of isolated growth hormone deficiency.
21196925 2010 Growth hormone-releasing hormone stimulates the secretion of interleukin 17 from human peripheral blood mononuclear cells in vitro.
20869425 2010 An association study between the genetic polymorphisms within GnRHI, LH? and FSH? genes and central precocious puberty in Chinese girls.
More...