Property Summary

NCBI Gene PubMed Count 69
PubMed Score 1918.44
PubTator Score 2158.53

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (3)

Gene RIF (47)

AA Sequence

MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERG      1 - 70
ARARLGRQVDSMWAEQKQMELESILVALLQKHSRNSQG                                     71 - 108
//

Text Mined References (70)

PMID Year Title